PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC008259.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 87aa    MW: 9257.73 Da    PI: 8.6795
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC008259.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26067.14.1e-213883146
        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46
                  +CaaCk+lrr+C+++Cvlapyfp ++p+kfa++h++FGasn++k+l
  EcC008259.10 38 PCAACKTLRRRCSESCVLAPYFPPSEPAKFAIAHRVFGASNIVKFL 83
                  7*******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.7663787IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-203883IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MESSDTGAFE SSPTSSLVPP SWSSPTPALP LPVVVASPCA ACKTLRRRCS ESCVLAPYFP  60
PSEPAKFAIA HRVFGASNIV KFLLVRH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056894.12e-52PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR07e-27LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A059C5R14e-52A0A059C5R1_EUCGR; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000194103e-26(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-22LOB domain-containing protein 1