PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC007434.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 364aa    MW: 39063.2 Da    PI: 9.8902
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC007434.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY77.71.3e-2493148359
                   -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   Dgy+WrKYGqK+vk+ + +rsY+rCt ++C++kk +e ++e ++++e++Y+++Hnh+
  EcC007434.10  93 DGYSWRKYGQKQVKSPKGSRSYFRCTNTECSAKK-IEICDELGHMLETVYRSQHNHD 148
                   9*******************************98.*********************7 PP

2WRKY97.58.8e-31226283259
                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    Dgy+WrKYGqK+vkg++ pr+YYrCtsagCpv+k++e++ ++ ++v itY+g H+h+
  EcC007434.10 226 ADGYRWRKYGQKMVKGNPRPRNYYRCTSAGCPVRKQIETAVDNANAVLITYKGVHDHD 283
                   6********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007741.8E-2491149IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.7E-2191150IPR003657WRKY domain
SuperFamilySSF1182903.27E-1992150IPR003657WRKY domain
PfamPF031061.7E-1893148IPR003657WRKY domain
PROSITE profilePS5081117.44293150IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.3E-31211285IPR003657WRKY domain
PROSITE profilePS5081130.917220285IPR003657WRKY domain
SuperFamilySSF1182901.31E-26221285IPR003657WRKY domain
SMARTSM007743.7E-34225284IPR003657WRKY domain
PfamPF031063.1E-23227282IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
EQVQQSHQEG LAVGAGETIQ TQTQIQLRLS PCAMATSELS PTSVTQSISS IPSPTPVEQG  60
SGMKTTGSCM PDPDIRSSYT RNAPRALRTS NIDGYSWRKY GQKQVKSPKG SRSYFRCTNT  120
ECSAKKIEIC DELGHMLETV YRSQHNHDPP KKANGMLEGK FEKSVGPVAK HLSNNHSARV  180
LDDSVPSSSS KEPAQEIPAK AKNPQPKPGK KAKIVVHAAG DVGISADGYR WRKYGQKMVK  240
GNPRPRNYYR CTSAGCPVRK QIETAVDNAN AVLITYKGVH DHDMPVPKKR HGPPSAPLVA  300
AAAPASMSSA PHKKVDAAQN GKASTKLSVD AGGELTGEAM ELGGEKAMES ARTLLSIGIE  360
IKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-25212285174WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048741.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
RefseqXP_010048742.10.0PREDICTED: probable WRKY transcription factor 32 isoform X2
SwissprotP595831e-102WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A059CSC00.0A0A059CSC0_EUCGR; Uncharacterized protein (Fragment)
STRINGGLYMA02G36510.11e-141(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.17e-92WRKY DNA-binding protein 32