PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC006978.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 156aa    MW: 17664.7 Da    PI: 10.4121
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC006978.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.41.4e-161353545
                  SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                   +  r +t+ kR++g++KKA+E  +LC+++ ++ii+++ g 
  EcC006978.40 13 KEKARRITYEKRKKGLMKKAQEFTTLCGVDTCMIIYGPAGS 53
                  567799********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.11152IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-17160IPR002100Transcription factor, MADS-box
CDDcd002662.75E-19287No hitNo description
SuperFamilySSF554551.96E-19295IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-10323IPR002100Transcription factor, MADS-box
PfamPF003195.0E-171153IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0003725Molecular Functiondouble-stranded RNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MGRGKLALEL IPKEKARRIT YEKRKKGLMK KAQEFTTLCG VDTCMIIYGP AGSTATTEPE  60
VWPASPEKVK LVIERYRSEG ADRRAKRTIG LPEFFANRKR KVDAELTKAR LANWEAKYPV  120
SETLIEGFSE EDLRRLLGSL GHKLEVAKAR LAVMKE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11225KEKARRITYEKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010034675.11e-107PREDICTED: agamous-like MADS-box protein AGL82
TrEMBLA0A059AH201e-91A0A059AH20_EUCGR; Uncharacterized protein
STRINGXP_010034675.11e-106(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.13e-25M-type_MADS family protein