PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC006970.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 85aa    MW: 9509.15 Da    PI: 9.1229
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC006970.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26063.17.2e-201563149
        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkal 49
                  +C aCk+lrr+C++dCv+a yfpa++p+kfanvh +FGasnv k+ +  
  EcC006970.30 15 PCTACKLLRRRCVQDCVFALYFPANEPHKFANVHTVFGASNVNKMFQVC 63
                  7********************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.0761485IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-191564IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MKESGRGQKQ GTLLPCTACK LLRRRCVQDC VFALYFPANE PHKFANVHTV FGASNVNKMF  60
QVCPSFLSAF VFPLHSSSLT LPEFI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056710.19e-31PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE92e-28LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A059C4X89e-31A0A059C4X8_EUCGR; Uncharacterized protein
STRINGVIT_19s0027g01120.t013e-29(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.19e-30LOB domain-containing protein 4