PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC005481.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family B3
Protein Properties Length: 159aa    MW: 17915.1 Da    PI: 10.1748
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC005481.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.42.7e-235703499
                  SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
            B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                  ++l++edesg+ W+++++y+ +s++yvltkGW++Fvk+++L++gD+v+F++d+ + ++l+++++r+
  EcC005481.10  5 QQLSFEDESGKWWRFRYSYWSSSQSYVLTKGWSRFVKDKRLDAGDVVLFHRDRADAERLFIGWRRR 70
                  5799**********************************************99889999******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.747171IPR003340B3 DNA binding domain
SMARTSM010190.0085371IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-24479IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.19E-20472IPR015300DNA-binding pseudobarrel domain
PfamPF023621.6E-20470IPR003340B3 DNA binding domain
CDDcd100177.17E-11561No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
GEATQQLSFE DESGKWWRFR YSYWSSSQSY VLTKGWSRFV KDKRLDAGDV VLFHRDRADA  60
ERLFIGWRRR GESSPGASAV AAETRVGGGG GGFYAGRRPY PGNNDGPSQP GSYAHGQAGN  120
LDFFFFLYMI SLSLSLSLSL SLSIEIEKRK RIRQVFIIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A3e-2577854125DNA-binding protein RAV1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059417.13e-60PREDICTED: B3 domain-containing protein At2g36080
SwissprotQ9FNI34e-36Y5625_ARATH; B3 domain-containing protein At5g06250
TrEMBLA0A059DJE94e-60A0A059DJE9_EUCGR; Uncharacterized protein
STRINGGLYMA10G08871.11e-39(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122028100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06250.29e-28B3 family protein