PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC004476.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 79aa    MW: 8824.24 Da    PI: 10.1733
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC004476.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.21e-131058250
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  +i+n + r vt+ + + g+   A ELS LC+++v +iifs++g l  + 
  EcC004476.30 10 KIDNPTGRLVTYRRCKDGLVQNAAELSKLCGTNVGLIIFSPNGGLISFT 58
                  79*****************************************999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554558.11E-18169IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.198161IPR002100Transcription factor, MADS-box
SMARTSM004327.1E-15160IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-13323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-141057IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-132338IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-133859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000911Biological Processcytokinesis by cell plate formation
GO:0006412Biological Processtranslation
GO:0009965Biological Processleaf morphogenesis
GO:0010090Biological Processtrichome morphogenesis
GO:0005730Cellular Componentnucleolus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016020Cellular Componentmembrane
GO:0022627Cellular Componentcytosolic small ribosomal subunit
GO:0003677Molecular FunctionDNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MGRDKLAVQK IDNPTGRLVT YRRCKDGLVQ NAAELSKLCG TNVGLIIFSP NGGLISFTSS  60
SRSIIIKFFR LEEFFSYHP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018720605.12e-24PREDICTED: agamous-like MADS-box protein AGL66
TrEMBLA0A022RTQ06e-17A0A022RTQ0_ERYGU; Uncharacterized protein (Fragment)
TrEMBLA0A438FFJ83e-15A0A438FFJ8_VITVI; Agamous-like MADS-box protein AGL66
STRINGXP_010038635.12e-24(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.14e-14AGAMOUS-like 21