PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC003255.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 363aa    MW: 37941 Da    PI: 9.4909
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC003255.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76.2e-3979138362
        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                   e+alkcprCds ntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  EcC003255.40  79 EAALKCPRCDSINTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 138
                   7789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3162127IPR003851Zinc finger, Dof-type
PfamPF027016.2E-3381136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.56282136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MVFSSLPTYL DPSNWQQQQN HHHHQAGNSG LNNQLPPAPP PPPPPPPQPH GGAGGNPGCS  60
IRPGSMVERA RLANIPMPEA ALKCPRCDSI NTKFCYFNNY SLSQPRHFCK TCRRYWTRGG  120
ALRNVPVGGG CRRNKRSKGS SSKSPITSGS SDQQASGGSV SSITSRGSSG LAGDILNRAT  180
AQIPGLRYMS PSSLNNLGEL GNSGEMGLNY AGIPGSMVGD AGNLSFQLGG NSSLLSMGSL  240
EHQWRLQQVT QQFPFMSSLD KHANLYSMDA STSGVEPSGL AGHHQVRPNL FMNSGASHTS  300
SVKVENINQD QLNLSRQLMG NSGANDQFWS VGGGSGGGGV GGGGGSAWTD LSGFSSSSTS  360
SAL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037844.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLA0A059A7100.0A0A059A710_EUCGR; Uncharacterized protein
STRINGVIT_08s0007g00180.t018e-95(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.12e-39Dof family protein