PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC003131.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family BBR-BPC
Protein Properties Length: 234aa    MW: 25289.8 Da    PI: 10.4958
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC003131.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind247.11.1e-7562234131301
     GAGA_bind 131 klealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkv.kkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkW 225
                    ++++p +++ + +k +k kk+++++k+p + ++k+ k+k++ +k+++ k ++++ +++k+ekk+++++++  ++D s++P P CsCtG+ r+CYkW
  EcC003131.30  62 ASTTEPAKSNSPGTKSAKPKKRKSSSKEPDQITSKALKQKQPRKKSSSgKGKGQSfPEAKREKKDLNMNIDLTNIDFSGVPSPYCSCTGIARVCYKW 158
                   3445566777777777888888888888888888866665555544440445555789*************************************** PP

     GAGA_bind 226 GnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                   G+GGWqS+CCt+++S yPLP+s+ r+g R+agrKmS+ga+ klL +La+eGydl +pvDLkdhWA+HGtnkfvti+
  EcC003131.30 159 GAGGWQSSCCTISVSEYPLPMSSSRPGVRLAGRKMSNGAYVKLLVRLASEGYDLTHPVDLKDHWARHGTNKFVTIK 234
                   ***************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012264.5E-771234IPR010409GAGA-binding transcriptional activator
PfamPF062177.1E-6866234IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0009658Biological Processchloroplast organization
GO:0009853Biological Processphotorespiration
GO:0055114Biological Processoxidation-reduction process
GO:0097339Biological Processglycolate transmembrane transport
GO:1901975Biological Processglycerate transmembrane transport
GO:0009706Cellular Componentchloroplast inner membrane
GO:0005506Molecular Functioniron ion binding
GO:0005524Molecular FunctionATP binding
GO:0008974Molecular Functionphosphoribulokinase activity
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
GO:0043879Molecular Functionglycolate transmembrane transporter activity
GO:1901974Molecular Functionglycerate transmembrane transporter activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGTYSNRGHI MPDANGGPSL SHIAWFYGSG FFPTPKVSSG PSSQTQLNPE DGLPVPPIRS  60
VASTTEPAKS NSPGTKSAKP KKRKSSSKEP DQITSKALKQ KQPRKKSSSG KGKGQSFPEA  120
KREKKDLNMN IDLTNIDFSG VPSPYCSCTG IARVCYKWGA GGWQSSCCTI SVSEYPLPMS  180
SSRPGVRLAG RKMSNGAYVK LLVRLASEGY DLTHPVDLKD HWARHGTNKF VTIK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056207.11e-173PREDICTED: protein BASIC PENTACYSTEINE7
SwissprotO822862e-75BPC7_ARATH; Protein BASIC PENTACYSTEINE7
TrEMBLA0A059C3N51e-171A0A059C3N5_EUCGR; Uncharacterized protein
STRINGXP_010056207.11e-172(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35550.45e-72basic pentacysteine 7