PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC002764.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 75aa    MW: 8717.26 Da    PI: 10.1969
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC002764.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.65.2e-31959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krienk+nrqvtfskRr g+lKKA+E+SvLCda+va+i+fs++gkl+ey++
  EcC002764.10  9 KRIENKINRQVTFSKRRCGLLKKAHEISVLCDADVALIVFSTKGKLFEYAT 59
                  79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.427161IPR002100Transcription factor, MADS-box
SMARTSM004326.3E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-29270IPR002100Transcription factor, MADS-box
CDDcd002653.28E-36269No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-31323IPR002100Transcription factor, MADS-box
PfamPF003195.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRCGLLK KAHEISVLCD ADVALIVFST KGKLFEYATD  60
CWYVLSARYI CFSRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-20165166MEF2C
5f28_B1e-20165166MEF2C
5f28_C1e-20165166MEF2C
5f28_D1e-20165166MEF2C
6byy_A1e-20165166MEF2 CHIMERA
6byy_B1e-20165166MEF2 CHIMERA
6byy_C1e-20165166MEF2 CHIMERA
6byy_D1e-20165166MEF2 CHIMERA
6bz1_A1e-20165166MEF2 CHIMERA
6bz1_B1e-20165166MEF2 CHIMERA
6bz1_C1e-20165166MEF2 CHIMERA
6bz1_D1e-20165166MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037260.12e-37PREDICTED: truncated transcription factor CAULIFLOWER A isoform X1
RefseqXP_010037261.11e-37PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform X2
SwissprotO223284e-35AGL8_SOLCO; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A0V0H9196e-37A0A0V0H919_SOLCH; Putative agamous-like MADS-box protein AGL8-like
STRINGXP_004172815.11e-37(Cucumis sativus)
STRINGXP_010037260.16e-37(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-36AGAMOUS-like 8