PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC001143.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 217aa    MW: 24342.6 Da    PI: 6.6999
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC001143.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.42.1e-37101101101
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   aCa+Ck++rrkC k+C+lapyfpa+qpk f+n+h+lFG+sn++k+lk++p++ +++am+s+++e+++ra+ Pv+G++  i++l  ql+q+ +el+++
  EcC001143.10  10 ACAVCKFQRRKCHKECPLAPYFPADQPKMFQNAHRLFGVSNITKILKQAPPDLKQEAMQSVIFESNMRAQYPVHGCCWYIRRLLCQLHQVTEELQHV 106
                   7**********************************************************************************************99 PP

        DUF260  98 keel 101
                   ++++
  EcC001143.10 107 NTQI 110
                   9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.7739110IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-3510107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0032958Biological Processinositol phosphate biosynthetic process
GO:0000828Molecular Functioninositol hexakisphosphate kinase activity
GO:0000829Molecular Functioninositol heptakisphosphate kinase activity
GO:0003993Molecular Functionacid phosphatase activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MTIKGGTSQA CAVCKFQRRK CHKECPLAPY FPADQPKMFQ NAHRLFGVSN ITKILKQAPP  60
DLKQEAMQSV IFESNMRAQY PVHGCCWYIR RLLCQLHQVT EELQHVNTQI AMCRDQVSAS  120
ASPSHYPPPP ELQLGNVHAD AVPTRQSFPG VFVNGESTKQ SIMSQQPYNY EPENTSHVGA  180
AQPNLASLPE LLMNYGADVF SYEDVPFDTI TIDKEES
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010030769.11e-165PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS62e-39LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A059AQV51e-165A0A059AQV5_EUCGR; Uncharacterized protein
STRINGVIT_14s0066g02460.t011e-49(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-40LOB domain-containing protein 27