PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC000125.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 139aa    MW: 16318.5 Da    PI: 8.6773
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC000125.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-1948101356
                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   k+++++++q++ Le++Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  EcC000125.10  48 KKRRLSADQVHFLERHFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARYK 101
                   56689************************************************9 PP

2HD-ZIP_I/II128.33.1e-4148138292
   HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                   kkrrls++qv++LE++Fe e+kLeperK +la++Lglqprqva+WFqnrRAR+ktkqlEk+y++Lk+++++lk+++++L ke+e+L+ e++
  EcC000125.10  48 KKRRLSADQVHFLERHFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARYKTKQLEKEYDSLKARFESLKADHDKLIKEKENLKGEVM 138
                   9*************************************************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-2039105IPR009057Homeodomain-like
PROSITE profilePS5007116.97343103IPR001356Homeobox domain
SMARTSM003892.6E-1945107IPR001356Homeobox domain
CDDcd000861.72E-1546104No hitNo description
PfamPF000461.0E-1648101IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.7E-2050111IPR009057Homeodomain-like
PRINTSPR000313.8E-67483IPR000047Helix-turn-helix motif
PROSITE patternPS00027078101IPR017970Homeobox, conserved site
PRINTSPR000313.8E-68399IPR000047Helix-turn-helix motif
PfamPF021833.3E-13103139IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
SKSVVNFEDV CGGGDTNTAP RPYLRQIDLK EEAVEEDYCD GNFQPPGKKR RLSADQVHFL  60
ERHFEVENKL EPERKIQLAK DLGLQPRQVA IWFQNRRARY KTKQLEKEYD SLKARFESLK  120
ADHDKLIKEK ENLKGEVMK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195103RRARYKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010044704.17e-95PREDICTED: homeobox-leucine zipper protein HAT5-like
RefseqXP_010044703.17e-95PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotA2X9802e-39HOX16_ORYSI; Homeobox-leucine zipper protein HOX16
SwissprotQ6YWR42e-39HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLA0A059D8Q78e-95A0A059D8Q7_EUCGR; Uncharacterized protein
STRINGGLYMA01G04890.11e-49(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.15e-40HD-ZIP family protein