PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dusal.0225s00021.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Dunaliellaceae; Dunaliella
Family bZIP
Protein Properties Length: 407aa    MW: 42653.5 Da    PI: 7.3799
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dusal.0225s00021.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.61.5e-14309370263
                           XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           +++kr+rr+ +NRe+ArrsR+RK++ + +Lee++ +L+   ++L++ +++l+++  ++ +++
  Dusal.0225s00021.1.p 309 PSSKRARRMLSNRESARRSRKRKQEHLGKLEEEIHQLKCDKQQLQESNQMLNQQFTSVSDHN 370
                           579**************************************************999887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-15308372IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.955310373IPR004827Basic-leucine zipper domain
PfamPF150359.7E-7311397No hitNo description
PfamPF001701.8E-10311363IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-12312365No hitNo description
SuperFamilySSF579591.55E-11312366No hitNo description
CDDcd147025.30E-15313363No hitNo description
PROSITE patternPS000360315330IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MAQEPVPAFH PLPRNDSETA FQDFLKRIPS SSNLALGQLS GGPSMSNLLD AAMPPQNSSL  60
HNEDTPQGEN GPKSSNGPTS GMPPRVSSLD FLARLVCSNP IPASSGTSQP QPPGSSSAPA  120
VGVKLEPLPE VHTSSGPLQE DPLRKMAPGS LALPSMAPVD LHSLNFCSGL SAGLPSMPHL  180
PGPLSTGLPN GLPMFPGLAN GLNGLPGPGG LELGGLPHLN LPPPNPTQAA AAALQLQGQL  240
AQAGSTPQSQ DGRQQHVPTP APAPVPAPSH GAAGNSARHS SKPSSTAETG SASEDSDGAD  300
NQKGGKGGPS SKRARRMLSN RESARRSRKR KQEHLGKLEE EIHQLKCDKQ QLQESNQMLN  360
QQFTSVSDHN KRLCEENERI KDELRFLRTE IQGQRRCGRD EGESNQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1324330RRSRKRK
2324331RRSRKRKQ
3326331SRKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP522889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-13basic leucine-zipper 42