PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dusal.0145s00020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Dunaliellaceae; Dunaliella
Family bZIP
Protein Properties Length: 372aa    MW: 39651.9 Da    PI: 8.3405
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dusal.0145s00020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.5e-1373134263
                           XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           +e++r+rr++kNR+ A rsR+RKka + eLe k + +e eN +L++ l  + +e + lk+++
  Dusal.0145s00020.1.p  73 EERRRQRRLAKNRLTAARSRERKKAILSELEAKLQGFEVENARLQEMLAAMGEENKDLKQQL 134
                           5789******************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-1271136IPR004827Basic-leucine zipper domain
PfamPF001704.7E-1173134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.80674137IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.19E-1076134No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-1376134No hitNo description
CDDcd147041.48E-1477128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MDSDWQLDPL HQGMDDPLDA FLFEPPALPD FHFAEMASCF PDVKQQQLID ELANEPKPQS  60
APEVDWKAIQ DPEERRRQRR LAKNRLTAAR SRERKKAILS ELEAKLQGFE VENARLQEML  120
AAMGEENKDL KQQLGQLCNP GSASVAAAAA AAAAADGAPG RADADRSTKG TRNSNLPATS  180
VKVLLALLLC MCLCKLTGEQ LGLVLGGALP LLALAQLIET EGGLRTVGVS HGGRTKRRRT  240
SNGRASSRST IDAAHNTPSR NSAMAKHHNQ QDNLSQVFAG LAHFLAAFGQ AAPQLCQGLQ  300
YMLHSRAACI PKGMFGPGNS SGGRTSSDGS SMEQKEECGS GSEVGRVVAQ GLPVKPSCRA  360
RSRQGPAGLL F*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17380ERRRQRRL
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP577378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.13e-07bZIP family protein