PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do030049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 375aa    MW: 40521 Da    PI: 6.5665
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do030049.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS225.62.3e-69463751262
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                 l++lL++cA  v++g + +a+ +L+++ +las d+  ++qRlaa+f+ ALa++l++ v++l++al ++++s  +     aa++ ++++ P++k+s+lt+
  Do030049.1  46 LINLLYQCAAEVAAGAFDRANYYLEQITQLASLDApHTLQRLAAVFADALARKLLNLVPGLSRALLSTANS-AEAHLIPAARRHLFDMLPFMKLSYLTT 143
                 6799*******************************99**************************99777776.345555578888*************** PP

        GRAS  99 NqaIleavegeervHiiDfd..isqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL. 194
                 N+aIlea+ege+ vH++D++  + + +QW+aL++a+ +R++gpp+lR+T+v++    ske l +++  Lak Ae++++pf+f++ v+ rl+dl++++L 
  Do030049.1 144 NHAILEAMEGEKFVHVVDLSgpAANTVQWIALFHAFRARRGGPPHLRVTAVHD----SKEFLANMAGVLAKEAEAFDIPFQFSA-VEARLDDLDPDALr 237
                 *******************9667899***************************....9**************************.799*******9996 PP

        GRAS 195 ...rvkpgEalaVnlvlqlhrll...................................................................desvslese 223
                    rv++gEala+++v qlhrll                                                                   +++ + + +
  Do030049.1 238 hvlRVRSGEALAISVVGQLHRLLaaddagrrhvpgstcltplqiiarsspssfgellerelntrlqlspgdsssvvsslspqspvlqasqAQQRPAAAK 336
                 6667888********************************************************************************999666666667 PP

        GRAS 224 rdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                   ++L++ + lsPk++vv+e ea+hn+++Flerf eal+
  Do030049.1 337 LGSFLQAARALSPKIMVVAEPEANHNAATFLERFDEALN 375
                 9***********************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.41820375IPR005202Transcription factor GRAS
PfamPF035148.1E-6746375IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MDIFPEDTVS SATSSPGSSL YSPSPHPHGY GAWVQELSHD QQGVRLINLL YQCAAEVAAG  60
AFDRANYYLE QITQLASLDA PHTLQRLAAV FADALARKLL NLVPGLSRAL LSTANSAEAH  120
LIPAARRHLF DMLPFMKLSY LTTNHAILEA MEGEKFVHVV DLSGPAANTV QWIALFHAFR  180
ARRGGPPHLR VTAVHDSKEF LANMAGVLAK EAEAFDIPFQ FSAVEARLDD LDPDALRHVL  240
RVRSGEALAI SVVGQLHRLL AADDAGRRHV PGSTCLTPLQ IIARSSPSSF GELLERELNT  300
RLQLSPGDSS SVVSSLSPQS PVLQASQAQQ RPAAAKLGSF LQAARALSPK IMVVAEPEAN  360
HNAATFLERF DEALN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012703080.10.0PREDICTED: scarecrow-like protein 3
TrEMBLK3Y6U20.0K3Y6U2_SETIT; Uncharacterized protein
STRINGSi009933m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.14e-68scarecrow-like 3