PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do029814.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 328aa    MW: 37509.4 Da    PI: 6.913
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do029814.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS217.95.4e-671832074373
        GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfA 169
                   e l+a++++  ++ + k++h+    +I + ++g++r+H++D++i   +QW+ L + La+R++gpp +++i ++  ++++    + +ee + rL+k+A
  Do029814.1  18 AMEFLKAYNIYMSACYFKKVAHIFSALTIERVMKGKSRLHVVDYGIHCAFQWAGLVRWLAKREGGPPsEMKIAAICCSQPSlfPVQWIEEQQYRLSKYA 116
                 67899**********************************************************999879*****988777778**************** PP

        GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                 +elg+pf f+v v++++e++ +e+L+++ +E+l+V+  ++  +l de     s  +rd+vL+ +k+++P+v++ +  +++h ++ Fl rf e l yysa
  Do029814.1 117 SELGLPFVFEV-VTTEWEKVCIENLNLDADEVLVVSDLFNFSTLKDEGIFFGSpnPRDTVLSNIKKMRPDVFIQSVLNCSH-GSCFLSRFREMLFYYSA 213
                 **********9.799******************************99987666559*************************.678************** PP

        GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                 lfd+l+a +prese r+++E+ llg  + n++aceg + ++r e++++W++r ++aG++++pl+  +++  k  ++k++ +g+ + e+ ++l++gWk+r
  Do029814.1 214 LFDMLDAVVPRESEPRSVLEQDLLGCCALNAIACEGVDVVQRPEKYRQWQSRNQRAGLRQLPLRPVVVEVLKDQIKKHHHKGFYLSEDGQWLLQGWKGR 312
                 *************************************************************************************************** PP

        GRAS 366 pLvsvSaW 373
                  L++   W
  Do029814.1 313 ILIAHLTW 320
                 ***98888 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.311301IPR005202Transcription factor GRAS
PfamPF035141.9E-6418320IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGTGSQLLKL LMEEGPSAME FLKAYNIYMS ACYFKKVAHI FSALTIERVM KGKSRLHVVD  60
YGIHCAFQWA GLVRWLAKRE GGPPSEMKIA AICCSQPSLF PVQWIEEQQY RLSKYASELG  120
LPFVFEVVTT EWEKVCIENL NLDADEVLVV SDLFNFSTLK DEGIFFGSPN PRDTVLSNIK  180
KMRPDVFIQS VLNCSHGSCF LSRFREMLFY YSALFDMLDA VVPRESEPRS VLEQDLLGCC  240
ALNAIACEGV DVVQRPEKYR QWQSRNQRAG LRQLPLRPVV VEVLKDQIKK HHHKGFYLSE  300
DGQWLLQGWK GRILIAHLTW VVEDGSSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-192027675328GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978028.20.0PREDICTED: scarecrow-like protein 9
TrEMBLK3YDL30.0K3YDL3_SETIT; Uncharacterized protein
STRINGSi012318m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.13e-84SCARECROW-like 14