PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do029084.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family LBD
Protein Properties Length: 146aa    MW: 15781.9 Da    PI: 4.5113
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do029084.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26098.28.5e-3119111101
      DUF260  11 kCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                 kC++dC+lapyfpa++p+++a+v+++FGasnv ++l +lp +er +a++++++eA+ r++dPvyG++g++ +lq ++  ++ ela++++++
  Do029084.1   1 KCSEDCILAPYFPASDPQRYACVQRIFGASNVARMLLNLPVHERGKAADTMAMEAHRRVQDPVYGCAGIVGRLQGEITAVQCELARIQAQI 91 
                 7************************************************************************************999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.618191IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-29188IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
KCSEDCILAP YFPASDPQRY ACVQRIFGAS NVARMLLNLP VHERGKAADT MAMEAHRRVQ  60
DPVYGCAGIV GRLQGEITAV QCELARIQAQ IAVHAAASAT QLNAPAPAAM PQQQEQGDGQ  120
LMQYPFQGLD ALLVDVNLVD DEMNTD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-2418621113LOB family transfactor Ramosa2.1
5ly0_B2e-2418621113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo029084.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025806770.12e-67LOB domain-containing protein 24-like
SwissprotP594673e-31LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594683e-31LBD24_ARATH; LOB domain-containing protein 24
SwissprotQ8LBW38e-31LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1E5VEI41e-102A0A1E5VEI4_9POAL; LOB domain-containing protein 12 (Fragment)
STRINGPavir.J09684.1.p3e-65(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-31LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]