PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do028825.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 726aa    MW: 79103.4 Da    PI: 7.7266
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do028825.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.4e-1852102555
                 SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  ++t+eq++eL++++e++++p+ ++r+ L +k+gL+ rqV++WFqN+R+++
  Do028825.1  52 KRHTPEQIQELKAAYEQCHHPDDKTRRALGAKIGLEARQVQYWFQNQRTQM 102
                 579*********************************************986 PP

2START103.73.1e-332124453205
                 HHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...EEEEEEEECTT.. CS
       START   3 aeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla...kaetlevissg.. 88 
                 ae+ +++++ +a+ +ep+Wv  +  e + ++++ +k  + +       +  ea r+ g+v +++a+lv +l + + +W+e+++   +  t   i sg  
  Do028825.1 212 AEASMEQFLMLATQGEPLWVPTPdgEVLSYQVYQKKMFPVEHavcpqgFVREATREAGMVRGTAADLVGILTNAN-RWSEMFPgvvAGVTAGDIVSGgi 309
                 68999******************8877888888888777655899999999************************.*******877555555555557* PP

                 .....EEEEEEEEXXTTXX-.SSXEEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.........-TTSE.....E-EESSEEEEEEEECTCEEEEEEEE CS
       START  89 .....galqlmvaelqalsp.lvpRdfvfvRyirqlgagdwvivdvSvdseqkppe........sssvv.....RaellpSgiliepksnghskvtwve 168
                        +qlm+ael + sp l++R   f+Ry++   + +w+++dvSvd   +p+         +  vv      ++llpSg+l+e+++ng++kvtwv 
  Do028825.1 310 ftsrdRLIQLMNAELWVQSPrLRNRSMNFLRYSKLTADRRWAVMDVSVDGILEPEGshkidlnvDNAVVpafhkGCRLLPSGCLVEDMGNGYCKVTWVV 408
                 **999**************95667*************************9999986322222222222233333489********************** PP

                 -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
       START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                 h+++++ +++ ++r+l +sg a ga +w+a lqrq+e
  Do028825.1 409 HAEYDETTVPTIFRPLHRSGKALGAHRWLASLQRQRE 445
                 **********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-173499IPR009057Homeodomain-like
SuperFamilySSF466891.71E-1539102IPR009057Homeodomain-like
PROSITE profilePS5007113.65345105IPR001356Homeobox domain
SMARTSM003891.4E-1448109IPR001356Homeobox domain
CDDcd000861.01E-1449102No hitNo description
PfamPF000468.0E-1652102IPR001356Homeobox domain
PROSITE profilePS5084826.833201449IPR002913START domain
CDDcd088754.60E-75205445No hitNo description
SuperFamilySSF559618.06E-19206443No hitNo description
SMARTSM002341.1E-10210446IPR002913START domain
PfamPF018529.1E-26212445IPR002913START domain
SuperFamilySSF559618.7E-10472691No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MDNEGHQQRN NNEDELHGLL VPEDQVDTES TGKDDNDEDY VPKPEMPSKR LKRHTPEQIQ  60
ELKAAYEQCH HPDDKTRRAL GAKIGLEARQ VQYWFQNQRT QMQAKALVQD SKTAQQENAA  120
LMAENVALRH AMLAKCCVTC GGETVPADLS LEKRRLLAEN ARLKHEYMRA TAFLGKIILE  180
ARPTEPPVSS SIHPVLSIVD GRAGRATLLR HAEASMEQFL MLATQGEPLW VPTPDGEVLS  240
YQVYQKKMFP VEHAVCPQGF VREATREAGM VRGTAADLVG ILTNANRWSE MFPGVVAGVT  300
AGDIVSGGIF TSRDRLIQLM NAELWVQSPR LRNRSMNFLR YSKLTADRRW AVMDVSVDGI  360
LEPEGSHKID LNVDNAVVPA FHKGCRLLPS GCLVEDMGNG YCKVTWVVHA EYDETTVPTI  420
FRPLHRSGKA LGAHRWLASL QRQREFLAVL HSSHVPSSDN TAAATAISSV GRRGILELAQ  480
RMMSSFYSAV SGPVTQPSSS IDEWHGSTGS GDKRIDAAVR MVTWRKSGSM LVLSASTTVW  540
LPNTPPRLVF EYLCNDQRRG EWDTLANGAA VKELGSIATG HLAGNAISVL CPNVTDGIRC  600
KMLILQETCT DASCSMVVYA PVEEKSMLAV MNGGEHASVF LLPSGFAILP DGHGKARHAA  660
CTSSAPGGHG NTAGSLLTVA CQALLLGSAP GNHAAGAFDD VGKLLRRAIK KIKVAVKAKI  720
VVPSLV
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo028825.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001349156.10.0uncharacterized protein LOC100383907
RefseqXP_023156325.10.0uncharacterized protein LOC100383907 isoform X1
TrEMBLA0A1E5WKZ30.0A0A1E5WKZ3_9POAL; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGSi033066m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-151HD-ZIP family protein