PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do028185.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 489aa    MW: 54765.3 Da    PI: 4.7359
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do028185.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS263.38.3e-8116348056373
        GRAS  56 svselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg. 153
                 ++s++y++l +++ s   +++ l+a+kl   ++ + k+  +  N +I +av+g +++Hi+ +++ +G+Q+p Ll  L++R++gpp++R+T+++ p++g 
  Do028185.1 163 TGSQVYQSLMAQRXS---VVDFLKAYKLHMVACCFKKVKVVFSNMTICNAVAGRSKLHIVEYGVRHGFQYPGLLYLLSKREGGPPEVRVTAIAVPQPGf 258
                 467888888887777...9******************************************************************************9* PP

        GRAS 154 .skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhn 249
                   ++++eetg+rL++ A+e+gvpf+f+  +a ++e+++ ++L+++p+E+l+Vn+     +l+desv ++s  +rd +L+ +++++P+v++++  +  ++
  Do028185.1 259 rPAHQIEETGRRLSNCAREFGVPFKFHX-IAAQWETVRAKDLNIDPDEVLVVNSECYCGNLMDESVLVDSpsPRDMLLSNIREMRPDVFIHAVVNGTYG 356
                 9***************************.799*********************************98887779************************** PP

        GRAS 250 sesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg 348
                 ++ Fl+rf eal ++sa fd  +a++pr+++er  +Er ++gr++ nv+acega+r+er et+++W  r ++aG++++pl+ +++k  +  +++++ + 
  Do028185.1 357 APFFLTRFREALFFFSAQFDVXDATIPRDNDERLLIERDIIGRSALNVIACEGADRVERPETYKQWLVRNHRAGLRQLPLDPEVVKASRNKVKTFYHRD 455
                 ************************************************************************************************999 PP

        GRAS 349 yrveeesgslvlgWkdrpLvsvSaW 373
                 + ++e++ +l+ gWk+r L+++S W
  Do028185.1 456 FLIDEDNRWLLVGWKGRVLYAMSLW 480
                 ************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.89178461IPR005202Transcription factor GRAS
PfamPF035142.9E-78163480IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MSATPEEFLG QGAYLAAPEP FSPSVFLDLP PTPRPTDAAA AAADDDDLVL PFISRMLMEE  60
DIDDKFFYQF PDHPALLNAQ QPYAQILSDA TASTSSDSAT TNTNNTLSPS SSDAPASADH  120
AWTYDAIELS QLLRSPPYPD MGVGLDDFTA DDVDDLLLQG QGTGSQVYQS LMAQRXSVVD  180
FLKAYKLHMV ACCFKKVKVV FSNMTICNAV AGRSKLHIVE YGVRHGFQYP GLLYLLSKRE  240
GGPPEVRVTA IAVPQPGFRP AHQIEETGRR LSNCAREFGV PFKFHXIAAQ WETVRAKDLN  300
IDPDEVLVVN SECYCGNLMD ESVLVDSPSP RDMLLSNIRE MRPDVFIHAV VNGTYGAPFF  360
LTRFREALFF FSAQFDVXDA TIPRDNDERL LIERDIIGRS ALNVIACEGA DRVERPETYK  420
QWLVRNHRAG LRQLPLDPEV VKASRNKVKT FYHRDFLIDE DNRWLLVGWK GRVLYAMSLW  480
VAEDNKPLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2718548080374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126191e-31CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankAC1370641e-31AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149671e-31AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980079.10.0PREDICTED: scarecrow-like protein 34
TrEMBLK3ZHD30.0K3ZHD3_SETIT; Uncharacterized protein
STRINGSi025985m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-109GRAS family protein