PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do028089.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 86aa    MW: 9801.45 Da    PI: 11.9835
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do028089.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.33.5e-332376255
     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                prlrWtp+LH++Fv+a+++LGG++kAtPk++l+lm+v gLt++hvkSHLQ+YR 
  Do028089.1 23 PRLRWTPDLHHCFVHAIHKLGGQDKATPKRVLQLMGVGGLTISHVKSHLQMYRN 76
                8****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.6531979IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-321979IPR009057Homeodomain-like
SuperFamilySSF466892.51E-172178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-252376IPR006447Myb domain, plants
PfamPF002493.9E-112475IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MVRTVVGRER SGGVRQYNRS KVPRLRWTPD LHHCFVHAIH KLGGQDKATP KRVLQLMGVG  60
GLTISHVKSH LQMYRNMRND IGMQGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-202478458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-202478458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-202478357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-202478357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-202478357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-202478357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-202478458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-202478458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-202478458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-202478458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-202478458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-202478458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo028089.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0689101e-104BT068910.1 Zea mays full-length cDNA clone ZM_BFc0191L18 mRNA, complete cds.
GenBankHQ8587021e-104HQ858702.1 Zea mays clone UT1158 G2-like transcription factor mRNA, partial cds.
GenBankKJ7268131e-104KJ726813.1 Zea mays clone pUT3230 G2-like transcription factor (GLK48) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698081.19e-55uncharacterized protein LOC101766248
RefseqXP_025792174.11e-54uncharacterized protein LOC112873442
SwissprotQ700D93e-27MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A1E5UIK91e-56A0A1E5UIK9_9POAL; Putative Myb family transcription factor
TrEMBLA0A2T8I6K32e-53A0A2T8I6K3_9POAL; Uncharacterized protein
TrEMBLK4AB702e-53K4AB70_SETIT; Uncharacterized protein
STRINGSi036127m3e-54(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76102950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.11e-31G2-like family protein