PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do027844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 241aa    MW: 26826.1 Da    PI: 8.9816
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do027844.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.44.9e-311871255
     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                pr+rWt+eLH++Fveave LGG+++AtPk+il+lm+vkg++++h+kSHLQ+YR+
  Do027844.1 18 PRMRWTEELHRQFVEAVECLGGQDEATPKRILQLMGVKGISISHIKSHLQMYRS 71
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-291472IPR009057Homeodomain-like
PROSITE profilePS5129410.4321474IPR017930Myb domain
SuperFamilySSF466895.2E-171673IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-251871IPR006447Myb domain, plants
PfamPF002491.5E-91970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MRGFERKGVR QYNRSEAPRM RWTEELHRQF VEAVECLGGQ DEATPKRILQ LMGVKGISIS  60
HIKSHLQMYR SSSNSSTHQS SLQKSTSTSN SKRVFLNRKD HCMYASPDGN TPASDKNIYA  120
MLRGCSRSSP YQIPPSLQEV FRSWEQSRGR VPWNSNLLTT EKAVRPSHTT SNKKSEKQTG  180
CDLTLSIGVW EDASSDADGS STISEELPAP AVGARCVATV KEEESMPALN LDLTISSSWL  240
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-161972457Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-161972457Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-171972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-171972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-171972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-171972356Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-161972457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-161972457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-161972457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-161972457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-161972457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-161972457Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo027844.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966301.11e-152uncharacterized protein LOC101769616
TrEMBLA0A1E5VP041e-179A0A1E5VP04_9POAL; Uncharacterized protein
STRINGSi007179m1e-152(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54933758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.19e-26G2-like family protein