PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do027693.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 140aa    MW: 16145.4 Da    PI: 5.6111
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do027693.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS105.38.5e-332139101234
        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp.fefnvlvakrledleleeLrv 196
                 +I++a+ g++++Hi+D+++  G+QW+ Ll+ L sR++g p+++iT++++p+++   +e++ee++ rL+k+A+e+g+p f+f++ +++++e++ +++L++
  Do027693.1   2 TIMQAMVGKSKLHIVDYGMCFGFQWAGLLHLLXSREGGVPEVKITAIDNPKPKicPAERIEEIECRLRKYAHEFGLPsFKFHT-ITRKWEEVCIKDLNT 99 
                 79**************************************************9***********************66*****.799************ PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsles..erdevLklvksl 234
                 + +E+l+Vn  ++  +l+de  + ++  +rd+vL+ +k++
  Do027693.1 100 DADEVLIVNDLFNFSTLMDEGEHFDDpsPRDTVLDNIKKM 139
                 ******************99888777669*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098521.9811140IPR005202Transcription factor GRAS
PfamPF035142.9E-302139IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MTIMQAMVGK SKLHIVDYGM CFGFQWAGLL HLLXSREGGV PEVKITAIDN PKPKICPAER  60
IEEIECRLRK YAHEFGLPSF KFHTITRKWE EVCIKDLNTD ADEVLIVNDL FNFSTLMDEG  120
EHFDDPSPRD TVLDNIKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677891.11e-63PREDICTED: scarecrow-like protein 34 isoform X1
RefseqXP_008677892.17e-64PREDICTED: scarecrow-like protein 34 isoform X2
RefseqXP_008677893.15e-64PREDICTED: scarecrow-like protein 33 isoform X3
TrEMBLK7TQL66e-64K7TQL6_MAIZE; GRAS transcription factor
STRINGGRMZM2G106356_P012e-63(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2273846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.13e-29SCARECROW-like 14