PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do027623.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 324aa    MW: 35379.8 Da    PI: 10.901
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do027623.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS110.91.7e-34362469220
        GRAS   9 AeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleave 107
                 + a ++g+   ++a L  ++ lasp+gdp qR+a+ f+eAL +r +++ ++l+  l+ + +++   + + aa++ f  ++P+l+ +  +aN++++ a++
  Do027623.1  36 VAAQEAGNIVTVNADLMFMKWLASPTGDPRQRVAFAFAEALGRRALQTLPGLSWGLQLQLAQQPAPAYTDAARRCFDALCPFLRGAASAANHTLVIAMK 134
                 556678888899999999999***********************************999999889899999**************************** PP

        GRAS 108 geervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl..vakrledleleeLrvkp..gEal 202
                 + ++vHi+D++   + QW+ Ll+ +a+Rpeg+pslR+T++++    + e l   g    + A +l+vpf fn +  + +r  +  + ++ +++  gEal
  Do027623.1 135 TGKHVHIVDLGGASPNQWLDLLRLFAARPEGAPSLRLTVMSE----QGEFLALPGCS-PQEAVRLHVPFIFNRVrcHIDRYFATVIASFGIDHrgGEAL 228
                 ******************************************....77777777776.789************9876777777778999888888**** PP

        GRAS 203 aVnlvlqlhrlldesvsl 220
                 ++ + lqlhrl +++ ++
  Do027623.1 229 VITSTLQLHRLIADECTI 246
                 ***********9888766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098520.4792324IPR005202Transcription factor GRAS
PfamPF035145.9E-3236246IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MPSLPVAAPA ILLGSQQLDN SRVSAFPVKA VIQHYVAAQE AGNIVTVNAD LMFMKWLASP  60
TGDPRQRVAF AFAEALGRRA LQTLPGLSWG LQLQLAQQPA PAYTDAARRC FDALCPFLRG  120
AASAANHTLV IAMKTGKHVH IVDLGGASPN QWLDLLRLFA ARPEGAPSLR LTVMSEQGEF  180
LALPGCSPQE AVRLHVPFIF NRVRCHIDRY FATVIASFGI DHRGGEALVI TSTLQLHRLI  240
ADECTIVLRT SCRSVYRRPH SWTASDNKGG QAPPRPLRPV AEADAADGAG GQPQRRQPLE  300
PRQQRLRLLR GPVQRPGGRW WRAA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439698.13e-74hypothetical protein SORBIDRAFT_09g018540
TrEMBLK3ZDF11e-95K3ZDF1_SETIT; Uncharacterized protein
STRINGSi024587m4e-95(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137161330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.16e-31scarecrow-like 3