PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do027366.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 402aa    MW: 42840.1 Da    PI: 10.7189
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do027366.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like74.71.3e-232441355
     G2-like 13 rFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Do027366.1  2 AFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 44
                6*****************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.715147IPR017930Myb domain
TIGRFAMsTIGR015573.5E-16246IPR006447Myb domain, plants
SuperFamilySSF466897.53E-8245IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-20245IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MAFVHAVERL GGQERATPKL VLQMMNVRGL SIAHVKSHLQ MYRSKKLDHE SGHERSAISS  60
VFSPMDFHMR RGDHRFHDMF FQRAAGSAIS SRLLPNGGFF GSRNAVSPEA SRLFGLLQRR  120
QPAVQTFDFK NYSSLRNQEW TFSQHAAAAA RAGAINDHGP AKGLIHDMIF RKDGKPTSHL  180
FDVRDAIASN RTSSAAAGAA DHGGRVGSSD WIGSSSRPLS RTMSAAASAG FALGSLHLLS  240
RGRGAAGSNG YHPNGDANTT SSDPVVSREA LGSRLETQLE AKNRTKVIGE MRNGTSAKRM  300
KTSMEENGGT PELQLSLSPN VGGDADKAKK RKILSIALSE QEVESDKMLP LSLSLSLRGG  360
DSGGEGSGGD AGRLDTVTGS SSKKAALGLS TLDLTMSIKA LE
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo027366.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432231e-137AC243223.1 Panicum virgatum clone PV_ABa006-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965558.10.0uncharacterized protein LOC101779064
TrEMBLA0A1E5V9V60.0A0A1E5V9V6_9POAL; Uncharacterized protein
STRINGPavir.Db01175.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-23G2-like family protein