PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do027262.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 506aa    MW: 54915.7 Da    PI: 6.4447
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do027262.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.54e-22100155156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++ +++t++q+++Le++F+++++p+ ++r+eL+k+lgL+ rqVk+WFqNrR+++k
  Do027262.1 100 KKRYHRHTPHQIQQLEAVFKECPHPDDKRRAELSKRLGLEPRQVKFWFQNRRTQMK 155
                 678899***********************************************998 PP

2START116.83e-3715626894206
                 EEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHH CS
       START  94 mvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglae 191
                 m+aelq+lsplvp R+++f+R++ ql +++w++vdvSvd  +  +     + +++lpSg+++++++ng +kvtwveh+++ ++++h+l+r+l++sgla+
  Do027262.1 156 MQAELQVLSPLVPrREVTFLRFCNQLAEDVWAVVDVSVDGLERDQCLVTNMNCRRLPSGCVVQDTPNG-CKVTWVEHTEYYEASVHQLYRPLLRSGLAF 253
                 89*************************************98887778889999***************.****************************** PP

                 HHHHHHHHTXXXXXX CS
       START 192 gaktwvatlqrqcek 206
                 ga +w+atlqrqce+
  Do027262.1 254 GAGRWLATLQRQCEC 268
                 *************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002342.8E-758268IPR002913START domain
Gene3DG3DSA:1.10.10.603.1E-2485157IPR009057Homeodomain-like
SuperFamilySSF466891.54E-2187156IPR009057Homeodomain-like
PROSITE profilePS5007118.28597157IPR001356Homeobox domain
SMARTSM003892.9E-2098161IPR001356Homeobox domain
CDDcd000862.75E-2199155No hitNo description
PfamPF000461.2E-19100155IPR001356Homeobox domain
PRINTSPR000313.5E-5128137IPR000047Helix-turn-helix motif
PROSITE patternPS000270132155IPR017970Homeobox, conserved site
PRINTSPR000313.5E-5137153IPR000047Helix-turn-helix motif
SuperFamilySSF559614.67E-17152268No hitNo description
PfamPF018521.3E-31156268IPR002913START domain
PROSITE profilePS5084824.53162271IPR002913START domain
SuperFamilySSF559611.28E-17289469No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MSFGDLLGGA GDAPGLHYPT YGGVFASSPA LSLAVADAGH RPDGSGERAG SVARGGGGSA  60
KDEPEDESRS AMSGGHLDVV LAGGSEDDED GEAGNPRKRK KRYHRHTPHQ IQQLEAVFKE  120
CPHPDDKRRA ELSKRLGLEP RQVKFWFQNR RTQMKMQAEL QVLSPLVPRR EVTFLRFCNQ  180
LAEDVWAVVD VSVDGLERDQ CLVTNMNCRR LPSGCVVQDT PNGCKVTWVE HTEYYEASVH  240
QLYRPLLRSG LAFGAGRWLA TLQRQCECLA ILMSSVAVPE HDSAVVPLEG KRSLLKLAER  300
MMENFCAGVS ASSAEWSKLD GLTGSMQKDV RVMVRKSVDE PGVPPGVVLS AATAVWMPVA  360
PERLFNFLRN EGLRAEWDIL SNGGPMQQMP TNTHLNSILI LQETCTDKSG AMVVYAPVDF  420
PAMQLVMGGG DSTYVALLPS GFAILPCGPS TCGVGHKTSG SLLTVAFQIL VNTQPTAKLT  480
TESVDTVYNL ISCTIEKIKV ALHCEV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195101PRKRKKR
296100RKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo027262.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823430.10.0homeobox-leucine zipper protein ROC4-like
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA0A1E5VSV40.0A0A1E5VSV4_9POAL; Homeobox-leucine zipper protein ROC5
STRINGPavir.Ga00993.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2104245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.11e-151homeodomain GLABROUS 1
Publications ? help Back to Top
  1. Zou LP, et al.
    Leaf rolling controlled by the homeodomain leucine zipper class IV gene Roc5 in rice.
    Plant Physiol., 2011. 156(3): p. 1589-602
    [PMID:21596949]
  2. Chou IT,Gasser CS
    Characterization of the cyclophilin gene family of Arabidopsis thaliana and phylogenetic analysis of known cyclophilin proteins.
    Plant Mol. Biol., 1997. 35(6): p. 873-92
    [PMID:9426607]