PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do027099.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family LBD
Protein Properties Length: 81aa    MW: 8910.99 Da    PI: 4.1469
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do027099.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260292.9e-091326192
      DUF260 61 lvyeAearardPvyGavgvilklqqqleqlka 92
                +++eA++r++dPvyG++gvi +lqq+++ ++ 
  Do027099.1  1 MMMEARWRMQDPVYGCTGVIDRLQQEIRAVRP 32
                589************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.0E-6131IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MMMEARWRMQ DPVYGCTGVI DRLQQEIRAV RPPRAAAPAS SETRTGCAVV VHAGAHGITV  60
NEEEDEEAPL MDPDEFLDLD G
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo027099.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444738.23e-12LOB domain-containing protein 24
TrEMBLA0A1E5VF281e-52A0A1E5VF28_9POAL; Uncharacterized protein (Fragment)
STRINGPavir.Cb01140.1.p2e-18(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562