PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do026738.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 293aa    MW: 32217 Da    PI: 4.6659
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do026738.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.6e-1970123356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k++++ ++q+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  Do026738.1  70 KKRRLAADQVRALERSFEVDNKLDPERKARIARDLSLHPRQVAVWFQNRRARWK 123
                 4557899**********************************************9 PP

2HD-ZIP_I/II126.11.5e-4069161193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl+++qv++LE+sFe ++kL+perK+++ar+L l+prqvavWFqnrRAR+ktkq+E+d++aL++++dal+ e ++L++++++L++e++e
   Do026738.1  69 EKKRRLAADQVRALERSFEVDNKLDPERKARIARDLSLHPRQVAVWFQNRRARWKTKQIERDFAALRARHDALRVECDALHRDKDALTAEIRE 161
                  69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.12E-1864127IPR009057Homeodomain-like
PROSITE profilePS5007116.47165125IPR001356Homeobox domain
SMARTSM003896.0E-1968129IPR001356Homeobox domain
PfamPF000463.5E-1670123IPR001356Homeobox domain
CDDcd000861.05E-1670126No hitNo description
Gene3DG3DSA:1.10.10.608.9E-1976124IPR009057Homeodomain-like
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PfamPF021839.6E-14125166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MKGPTSRGSL VISQAFTDQQ EDSCRNMERH GVDGDGTAAA ERDDVEAGAY DEEEDDDEEL  60
AGSRGGLGEK KRRLAADQVR ALERSFEVDN KLDPERKARI ARDLSLHPRQ VAVWFQNRRA  120
RWKTKQIERD FAALRARHDA LRVECDALHR DKDALTAEIR ELRDKVEKQM DVKLESPEEL  180
LPVAAGTEAA AAAVYKDGST DSDSSAVFNE EASPYSGAAF DHQHHHQAHP SFTGFTSFLA  240
SSSSLSSSFP SLYHGGSHLD QEADGFLSAT AADGFFAEEQ GIGLGSWYSG EGW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117125RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo026738.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0420270.0BT042027.1 Zea mays full-length cDNA clone ZM_BFb0113G23 mRNA, complete cds.
GenBankKJ7275560.0KJ727556.1 Zea mays clone pUT5416 HB transcription factor (HB127) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792352.11e-161homeobox-leucine zipper protein HOX8-like isoform X1
SwissprotQ338Z73e-93HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A1E5UM860.0A0A1E5UM86_9POAL; Homeobox-leucine zipper protein HOX8
STRINGPavir.J35191.1.p1e-161(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.12e-41homeobox protein 16
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]