PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do026508.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family VOZ
Protein Properties Length: 560aa    MW: 61718.9 Da    PI: 5.2521
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do026508.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4121.1e-1262504671217
         VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                 p+ps++lgp calwdc rp+ gse+  dyc+ +ha laln+ gl+gt+pv+rp+gidlkdg+lfaal akvqgk+vgip+c gaat+kspwna+elfdl
  Do026508.1 250 PSPSQYLGPICALWDCGRPVGGSEDSGDYCNPYHAGLALNDdGLLGTRPVMRPRGIDLKDGPLFAALIAKVQGKNVGIPVCGGAATSKSPWNAPELFDL 348
                 89**************************************9799******************************************************* PP

         VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksak 197
                 sllege++rewlffd+prrafesgnrkqrslpdy+grgwhesrkqvmk+f+glkrsyymdpqpsss+ewhl+eyein +dalalyrle+k++d+kksak
  Do026508.1 349 SLLEGESLREWLFFDTPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFAGLKRSYYMDPQPSSSHEWHLFEYEINASDALALYRLEYKSSDSKKSAK 447
                 *************************************************************************************************** PP

         VOZ 198 gkvskdsladlqkklgrlta 217
                 +k++++sl+++q++++rlta
  Do026508.1 448 SKLASNSLNEIQQQMVRLTA 467
                 ******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MAGDPAAGGG GAAHPASGGK GSRSSTRHRQ FRDRAKNRVD DLEEMFSGLQ SARKESRSAD  60
AAVLEEQNSQ GNNREAADPP SETLRLLQLA VAEEEDDATS KFTVPRSPLQ VPAFHQNHEQ  120
GHEQDVRMPN LEQQCEAVAG GAAPSQQSLG QGDCGEVSAV ANAMFNDQMY YIDQELSIED  180
FLHGDDYKID LPSSNEDHFN NLHGIGQLEH QQFDLPLDLP PHSYVDANNS EQNTGDVFVH  240
MSDLLTTIWP SPSQYLGPIC ALWDCGRPVG GSEDSGDYCN PYHAGLALND DGLLGTRPVM  300
RPRGIDLKDG PLFAALIAKV QGKNVGIPVC GGAATSKSPW NAPELFDLSL LEGESLREWL  360
FFDTPRRAFE SGNRKQRSLP DYNGRGWHES RKQVMKDFAG LKRSYYMDPQ PSSSHEWHLF  420
EYEINASDAL ALYRLEYKSS DSKKSAKSKL ASNSLNEIQQ QMVRLTADSP VENKRSARSK  480
PKANKETNAN VFAHVNNPSQ VNAPNAYQAA RQVNQMTFLN ENVVYGPHLP HSENVVYGPH  540
LPHGYSAEGS SFFWNPRDGT
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo026508.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0396290.0BT039629.1 Zea mays full-length cDNA clone ZM_BFc0035D15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961501.10.0transcription factor VOZ1
TrEMBLA0A1E5UJZ20.0A0A1E5UJZ2_9POAL; Transcription factor VOZ1
STRINGPavir.Ca01693.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-115vascular plant one zinc finger protein