PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do026445.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 296aa    MW: 32681.2 Da    PI: 7.6393
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do026445.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1691.5e-52111401129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kg 97 
                 +ppGfrFhP+d+elv +yL ++++g+ +    +i +vd++k+ePwdLp+++  + kewyfF +rd+kyatg+r+nrat sgyWkatgkd++v++   + 
  Do026445.1  11 MPPGFRFHPRDDELVLDYLLHRLSGRAHAG-AAIVDVDLNKCEPWDLPEAAGVGGKEWYFFNQRDRKYATGHRTNRATVSGYWKATGKDRAVVAGgdDA 108
                 79*************************887.78***************8888899**************************************986666 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                 ++vg++ktLvfy+grapkg+kt+Wvmhe+rle
  Do026445.1 109 AVVGMRKTLVFYRGRAPKGRKTEWVMHEFRLE 140
                 77***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-582175IPR003441NAC domain
PROSITE profilePS5100556.3811175IPR003441NAC domain
PfamPF023657.8E-2612139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MSSISMVEAR MPPGFRFHPR DDELVLDYLL HRLSGRAHAG AAIVDVDLNK CEPWDLPEAA  60
GVGGKEWYFF NQRDRKYATG HRTNRATVSG YWKATGKDRA VVAGGDDAAV VGMRKTLVFY  120
RGRAPKGRKT EWVMHEFRLE PPAPPPPPQH HLPAPATARH QRLKEDWVLC RVFYKSRTTT  180
PKLPSEDAHD GTPSTELDLP AALPLAPLVD TYTAFGAAPT VTEQVSCFSG LPALPFKRPV  240
SFGDLLAFDT SEKVSIGTVM LSSMSSNSSS SVLELPPNCN WNQENVLSQM WDPLGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-46618215174NAC domain-containing protein 19
3swm_B3e-46618215174NAC domain-containing protein 19
3swm_C3e-46618215174NAC domain-containing protein 19
3swm_D3e-46618215174NAC domain-containing protein 19
3swp_A3e-46618215174NAC domain-containing protein 19
3swp_B3e-46618215174NAC domain-containing protein 19
3swp_C3e-46618215174NAC domain-containing protein 19
3swp_D3e-46618215174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9581281e-127EU958128.1 Zea mays clone 1674566 NAC domain-containing protein 21/22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972635.11e-160PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE65e-81NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLK3YIW11e-160K3YIW1_SETIT; Uncharacterized protein
STRINGSi014180m1e-160(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12977.11e-73NAC family protein