PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do026330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 612aa    MW: 69117 Da    PI: 5.3165
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do026330.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS309.67.4e-952326051373
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l+ lL++cA+av++gd   a++lL ++++++sp+gd++qRla++f                       t+    +e  +a++l+  v+ +   ++   N
  Do026330.1 232 LRALLIHCAQAVATGDRLIATELLRKIKQRSSPRGDATQRLAHCFXXXXXXXXXXXXXXXXXXXXXXXTP---AVELHKAYQLYLTVCCFQMAAFKFSN 327
                 5789*******************************************99999998555555555555555...89999********************* PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                 ++Il+a++g ++vHi+D++  +G+QWp Ll  La+   +gpp+++iT+++ p++g     ++e+tg+rL++fA+++gvpf+f+  ++ ++e++ +++L+
  Do026330.1 328 RTILKATAGRKKVHIVDYSDHYGFQWPILLGCLATNCeGGPPEVKITVISLPQPGfrPGARIEQTGRRLSNFARRCGVPFKFHS-IVAKWETVCVDDLD 425
                 **********************************877699**************9999**************************.6999********** PP

        GRAS 196 vkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                 ++pgE l+Vn+ ++ ++l+de  +++s  +rd vL+ +++++P++++++ +++++n + F++rf eal yysa+fd+++++++r+s+eri vEr llgr
  Do026330.1 426 TEPGELLIVNSLFHFEKLMDEGDDIDSpcPRDMVLNNIQKMRPDLFILCTENSSYNVPFFVTRFREALFYYSAMFDMMDTTASRDSDERILVERDLLGR 524
                 **********************99999999********************************************************************* PP

        GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  + nv+aceg +r++r et+++W +r+ +aG++++pl+ ++ + ++  l+  + + + ++ ++++l++gWk+r L+++S W
  Do026330.1 525 CALNVIACEGPDRVKRPETYKQWTARIARAGLRQLPLDPEVLTVVRKNLKDGYHRDFVIDVDQQWLLQGWKGRILYAMSTW 605
                 **************************************************999899************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.812206586IPR005202Transcription factor GRAS
PfamPF035142.6E-92232605IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MQDDALLLPF ITRVLMEEED IDDNPDHPAL LEAQQPFADI LSDAAASSTN KSSAFDSPAF  60
AANATWPYDP VELSHQLLTH PDMGVIGLHG GTEDDSLAST LFGGCNRVTM DMLNQAFLKG  120
MEEANKFLPT TTTNSLSDLE DSSVDHLRRD NNGRGRKNRH NNDWDSLEAE IGRSCKLMLP  180
EAEEANETVD KCILNVYQSL FERMMNLSIS VDIEAEKKIK KEKGSTNEAV DLRALLIHCA  240
QAVATGDRLI ATELLRKIKQ RSSPRGDATQ RLAHCFXXXX XXXXXXXXXX XXXXXXXXXT  300
PAVELHKAYQ LYLTVCCFQM AAFKFSNRTI LKATAGRKKV HIVDYSDHYG FQWPILLGCL  360
ATNCEGGPPE VKITVISLPQ PGFRPGARIE QTGRRLSNFA RRCGVPFKFH SIVAKWETVC  420
VDDLDTEPGE LLIVNSLFHF EKLMDEGDDI DSPCPRDMVL NNIQKMRPDL FILCTENSSY  480
NVPFFVTRFR EALFYYSAMF DMMDTTASRD SDERILVERD LLGRCALNVI ACEGPDRVKR  540
PETYKQWTAR IARAGLRQLP LDPEVLTVVR KNLKDGYHRD FVIDVDQQWL LQGWKGRILY  600
AMSTWVVNGA TT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-392366058374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450068.10.0hypothetical protein SORBIDRAFT_05g027783, partial
TrEMBLC5Y8M00.0C5Y8M0_SORBI; Putative uncharacterized protein Sb05g027783 (Fragment)
STRINGSb05g027783.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-127SCARECROW-like 14