PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do026258.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TCP
Protein Properties Length: 177aa    MW: 18366.9 Da    PI: 7.7885
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do026258.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1012e-3159124772
         TCP   7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                 ++ ++h+kv gR+RRvR++a +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++
  Do026258.1  59 SSADRHAKVAGRGRRVRIPAMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEA 124
                 678********************************************************7776633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.3E-2759125IPR005333Transcription factor, TCP
PROSITE profilePS5136924.4760114IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MSSSSELVLY NLVPAPQTLN PPPPHAAAAV SGDLSIATGV AAPPEVPLRG RVRRPVGSSS  60
ADRHAKVAGR GRRVRIPAMV AARVFQLTRE LGHRTDGETI EWLLRQAEPS IIAATGTGVT  120
PEEAPSAPVP VSPVAATPSL MPVPYYTALL MQPPPTVNEV TTASASVSGT ATEENNN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008663070.17e-96PREDICTED: transcription factor PCF1-like
SwissprotO238756e-55PCF1_ORYSJ; Transcription factor PCF1
TrEMBLK7TSC88e-96K7TSC8_MAIZE; TCP transcription factor
STRINGGRMZM2G096610_P012e-95(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.12e-30TCP family protein