PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do026119.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family LBD
Protein Properties Length: 167aa    MW: 18613.7 Da    PI: 5.9263
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do026119.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260101.57.5e-321948101
      DUF260   8 lrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                 lrr+Ca+dCvlapyfp +qp+++a vh +FG++nv+++l++lp +er +a++++  eA++r++dPvyG++gvi +lqq+++ +++ela+++++l
  Do026119.1   1 LRRRCAPDCVLAPYFPXSQPRRYADVHAVFGTNNVTRVLQSLPVQERGRAADTMGTEARWRMQDPVYGCTGVIDRLQQEIRAVQHELARTRAQL 94 
                 69***************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031954.9E-31191IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089120.373194IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
LRRRCAPDCV LAPYFPXSQP RRYADVHAVF GTNNVTRVLQ SLPVQERGRA ADTMGTEARW  60
RMQDPVYGCT GVIDRLQQEI RAVQHELART RAQLAVHVQG TALLQRTQQP TPLLPPPQPL  120
APAPTVAVHA GAHGVTVHEE EDEEAPLMDP DEFLDLPDNG RTENRNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-27110018117LOB family transfactor Ramosa2.1
5ly0_B1e-27110018117LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo026119.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444738.22e-62LOB domain-containing protein 24
TrEMBLA0A1E5UP231e-117A0A1E5UP23_9POAL; LOB domain-containing protein 23 (Fragment)
STRINGPavir.Cb01140.1.p3e-65(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-33LOB domain-containing protein 24