PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do025831.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family LBD
Protein Properties Length: 324aa    MW: 34701.9 Da    PI: 9.0816
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do025831.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260106.71.9e-3377174299
      DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 CaaCk++r+kC+++C+l pyfpa++p kf+nv ++FG++n+l++l+++p+ +  + ++++vye++ar+ dPv+G+vgvi +l+ ql  ++ el++l++
  Do025831.1  77 CAACKHKRQKCPPGCILLPYFPADDPDKFRNVLRVFGVKNLLRTLRDVPQPRWGACVRTIVYESKARLMDPVRGCVGVIEDLEGQLVDTAIELEVLRR 174
                 ******************************************************************************************99998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.4475176IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3277173IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MSAPPPWSPP SGGAIASDSE PDSPSSGSFS STPSSPAPAP GGGSSVASSS SPSSSTPPPP  60
PAARAGKSAA PPTPPGCAAC KHKRQKCPPG CILLPYFPAD DPDKFRNVLR VFGVKNLLRT  120
LRDVPQPRWG ACVRTIVYES KARLMDPVRG CVGVIEDLEG QLVDTAIELE VLRRRQEAYR  180
QAKRRLQLQQ PPNPTHGRST ASPRGITNLD AARQLQQSGR TTSVDMMQPQ GPYGNAWSPA  240
TTGLTAAQPQ LLATQPHLSE TQPQFSVMRP HQFPGTQPHQ FPGTQPQQRA MHRQTATRGA  300
TAMLRDDFGG DAWANDERDD PDDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-23701701105LOB family transfactor Ramosa2.1
5ly0_B2e-23701701105LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo025831.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436474.18e-49LOB domain-containing protein 22
TrEMBLA0A1E5VZ070.0A0A1E5VZ07_9POAL; Uncharacterized protein
STRINGSi012657m1e-103(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1968178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.14e-22LOB domain-containing protein 22