PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do025758.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 362aa    MW: 38282 Da    PI: 8.323
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do025758.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.7e-31239294156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r+ W+peLH++Fv a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Do025758.1 239 KARRTWSPELHRQFVAALSQLGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 294
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.318236296IPR017930Myb domain
SuperFamilySSF466891.77E-16237297IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-28237297IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-25239294IPR006447Myb domain, plants
PfamPF002497.8E-7241292IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGLDVGEIGM GADLSLDLRY FAAKAVRQAR DAPASDVDAC IRRLEEERGK IEMFRRELPL  60
CARLLAEVID VMKGEAGKKT KSDRKVVAAA EEDGAAGDKS KWMSTAQLWT GDSGREDAES  120
EKQDKGRSSP EAMSRGGGGG GGFLPFKAVG SGAPAFAPLC LRVEDKAADA GMPDLSLLSP  180
PASKSAPAAA GAAEESRRQV VGFAQAAARA VAMTPSAPSL SLQSQSQQTA QQQQQQARKA  240
RRTWSPELHR QFVAALSQLG GAQVATPKQI RELMKVDGLT NDEVKSHLQK YRLHNRRAPG  300
SAAVSPPIVL VGGLWIPQEQ SSSQSGSPQG PLHFSTSGIA VSSAATVSCE EEDGRSESYG  360
WK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14239292154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo025758.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025804519.10.0transcription factor NIGTH1-like
TrEMBLA0A1E5UUC50.0A0A1E5UUC5_9POAL; Myb family transcription factor EFM
STRINGPavir.Ba02240.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.19e-34G2-like family protein