PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do025322.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 347aa    MW: 37660.5 Da    PI: 8.8097
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do025322.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-5391361128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeel+ +yL++++++  +++ ++i++vdiyk++PwdLp++++ ++kewyfFs+rd+ky++g r+nra+ sgyWkatg+dk+++s+ +ge
  Do025322.1   9 LPPGFRFHPTDEELILHYLRNRAANAVCPV-DIIADVDIYKFDPWDLPSRAAYGDKEWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSSaTGE 106
                 79****************************.99***************888889***************************************998899 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  vg+kk Lvfy+gr pkg+kt+W+mheyrl
  Do025322.1 107 SVGVKKALVFYRGRPPKGTKTNWIMHEYRL 136
                 9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-653169IPR003441NAC domain
PROSITE profilePS5100562.2319169IPR003441NAC domain
PfamPF023658.8E-2810136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MIMANPAMLP PGFRFHPTDE ELILHYLRNR AANAVCPVDI IADVDIYKFD PWDLPSRAAY  60
GDKEWYFFSP RDRKYPNGIR PNRAAGSGYW KATGTDKPIH SSATGESVGV KKALVFYRGR  120
PPKGTKTNWI MHEYRLAADA QAGNTYRPMK FRNASMRLDD WVLCRIYKKT SQASPMAVPP  180
LSDHEQDEPC GFDDNPYAAS SSAAMLVQGA YPVVQQAAAV APQRMHRIPS LSELFSDPSL  240
AHFFEDGGVA ADMARLDQQQ QQHGGTLLGH PITSQLLLSN GGIMPGQMDS SASTSAGAGD  300
GAAGKRKRSE TSTGAGAKKP NGSCFGATFQ IGNGLQGSLS HHMLAPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-74917317169NAC domain-containing protein 19
4dul_A4e-74917317169NAC domain-containing protein 19
1ut7_B4e-74917317169NO APICAL MERISTEM PROTEIN
1ut7_A4e-74917317169NO APICAL MERISTEM PROTEIN
1ut4_B4e-74917317169NO APICAL MERISTEM PROTEIN
1ut4_A4e-74917317169NO APICAL MERISTEM PROTEIN
3swp_D5e-74917320172NAC domain-containing protein 19
3swp_C5e-74917320172NAC domain-containing protein 19
3swp_B5e-74917320172NAC domain-containing protein 19
3swp_A5e-74917320172NAC domain-containing protein 19
3swm_D5e-74917320172NAC domain-containing protein 19
3swm_C5e-74917320172NAC domain-containing protein 19
3swm_B5e-74917320172NAC domain-containing protein 19
3swm_A5e-74917320172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280290.0KJ728029.1 Zea mays clone pUT6168 NAC transcription factor (NAC44) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984512.10.0PREDICTED: NAC domain-containing protein 72-like
TrEMBLK4ABP60.0K4ABP6_SETIT; Uncharacterized protein
STRINGSi036303m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.16e-83NAC-like, activated by AP3/PI