PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do025061.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 709aa    MW: 78023.1 Da    PI: 4.6528
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do025061.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM146.11.8e-45101352128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 ppGfrF+Ptdeelv ++Lk+++ + + +    +++vd+yk++P++Lp +  +++++++w+fFs+ d+ky++g+r++r+t +gyWkatgkd+ ++  +g+
  Do025061.1  10 PPGFRFSPTDEELVLYFLKRRIYSGRPSP--YVADVDVYKSHPSHLPeRsVLQTGDRQWFFFSRMDRKYPNGSRASRTTGDGYWKATGKDRFICG-GGR 105
                 8********************99998655..69*************95347788999*************************************9.99* PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 +vg kktLv+++grap+ge+tdWvmhey+l
  Do025061.1 106 AVGNKKTLVYHHGRAPRGERTDWVMHEYTL 135
                 ****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-527158IPR003441NAC domain
PROSITE profilePS5100551.2859158IPR003441NAC domain
PfamPF023658.8E-2410135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
MEAPPPRRWP PGFRFSPTDE ELVLYFLKRR IYSGRPSPYV ADVDVYKSHP SHLPERSVLQ  60
TGDRQWFFFS RMDRKYPNGS RASRTTGDGY WKATGKDRFI CGGGRAVGNK KTLVYHHGRA  120
PRGERTDWVM HEYTLLADVL PPAAEGRESY ALYKLFQKSG SGPKNGEQYG APFREEDWLD  180
DNEEGVTTDA APNSVPNTNN CPPTAEEHAI ADRELPIEDL DELLSQIGND QELFGEAHSD  240
FSTPVTSHGQ GHGWLSDGGD KTEVADASIS SSAVVVAVNT CTDLPLGDIE QLLMQMSDDQ  300
QNAELFSDFS TPVPQQQLQC DNHQVWLDAH RGQEVCAADP TASSVAVVTT ECADTELPFG  360
DLEGLLLPIA IDRDMVEPLS HLSVPIPHHN FNQVGIGDFH ESHGAPVGNL SCIVQESTFD  420
LQTVLRSQIP QSNLTNVPFR GETNSSEATS VSHSVSGYNQ DANEEFLEIN DFFDLEDVEQ  480
SANCTATEHL ISATNGMFDN LEYSDAPTFL PGPFDTAGVV PENQFFDFGN SGIQNQGYQY  540
TTEVRAHNQA ALNVRSHMKD NHVVLSSHAS GTLNLHVGNE PPNRSSTASQ SWFNAALSAL  600
LDSVPSSPAL AAEIENTVIN RTLQRISSFR SHQAAGEENT VINRTLQRIS SFRSQQAASE  660
EPSTPRIQVT RGGRLMSISL LVILAAFMWT FTAGSALKFC KGLWKSSFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-431013516140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957233.10.0PREDICTED: uncharacterized protein LOC101780745
TrEMBLK3ZR580.0K3ZR58_SETIT; Uncharacterized protein
STRINGSi029088m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP91282840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34180.12e-68NAC domain containing protein 16