PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do024521.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 353aa    MW: 39081.1 Da    PI: 6.1921
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do024521.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.37.1e-54221471127
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdee++++yL++k+ + +++   vi evd++kvePw+Lp++++ +ekewyfF+++d ky+tg+r+nratk+gyWkatgkdke+++ +g l
  Do024521.1  22 LPPGFRFHPTDEEIITHYLNHKTLDPRFTS-GVIGEVDLNKVEPWHLPAHARMGEKEWYFFCHKDMKYPTGTRTNRATKEGYWKATGKDKEIFRGRGIL 119
                 79*************************999.99***************988999********************************************* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyr 127
                 vg+kktLvfy+grap+gekt Wvmhe+r
  Do024521.1 120 VGMKKTLVFYTGRAPRGEKTGWVMHEFR 147
                 ***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-6115172IPR003441NAC domain
PROSITE profilePS5100556.50622172IPR003441NAC domain
PfamPF023656.0E-2823147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MSEVSVINQA EVEDAGAGQL DLPPGFRFHP TDEEIITHYL NHKTLDPRFT SGVIGEVDLN  60
KVEPWHLPAH ARMGEKEWYF FCHKDMKYPT GTRTNRATKE GYWKATGKDK EIFRGRGILV  120
GMKKTLVFYT GRAPRGEKTG WVMHEFRPEG KLPQSVPRSA KDEWAVCKVF NKELAARTEA  180
PMAVAGAELE RVGSLGFLSE LLDSAELPPL IGADVDEVID FKGVASTSGA HASAPGTSYL  240
PVKMEEHAQL QYHNYQHQPP MFYPNQYFSL PAVNSGDLPP AIRRYCKAEQ QVVSGQTTSV  300
VSPSRETGLS TDPNAAAGGC TEISSAVTPS SSHQFLHELD DPLLMNVADF WKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-501917717173NAC domain-containing protein 19
3swp_C3e-501917717173NAC domain-containing protein 19
3swp_B3e-501917717173NAC domain-containing protein 19
3swp_A3e-501917717173NAC domain-containing protein 19
3swm_D3e-501917717173NAC domain-containing protein 19
3swm_C3e-501917717173NAC domain-containing protein 19
3swm_B3e-501917717173NAC domain-containing protein 19
3swm_A3e-501917717173NAC domain-containing protein 19
4dul_B3e-501917714170NAC domain-containing protein 19
4dul_A3e-501917714170NAC domain-containing protein 19
1ut7_B3e-501917714170NO APICAL MERISTEM PROTEIN
1ut7_A3e-501917714170NO APICAL MERISTEM PROTEIN
1ut4_B3e-501917714170NO APICAL MERISTEM PROTEIN
1ut4_A3e-501917714170NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9563950.0EU956395.1 Zea mays clone 1562064 GRAB2 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984514.10.0PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLJ29e-82NC100_ARATH; NAC domain-containing protein 100
TrEMBLK4A9T30.0K4A9T3_SETIT; Uncharacterized protein
STRINGSi035639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.21e-89Arabidopsis NAC domain containing protein 87