PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do024262.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 163aa    MW: 19068.6 Da    PI: 6.9617
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do024262.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS45.31.5e-1488156305373
        GRAS 305 rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +er et+++W+ r ++aG++++pl+++++++++  +++ + +++ ++ ++++l+  Wk+r L+++SaW
  Do024262.1  88 IVERPETYKQWKVRNHRAGLRQLPLDSDVVNDVRETVKNQYHKEFVIDMDHQWLLEEWKGRILYAISAW 156
                 479**************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035145.1E-1288156IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MRMSSTPLPT RPRLLGGKNK YNYQDDLEAD KDRNNKLMVS EPEETGEMVD YIIANGYDLC  60
LEKMKDLRIV MDSKAEKNNK KGSARAHIVE RPETYKQWKV RNHRAGLRQL PLDSDVVNDV  120
RETVKNQYHK EFVIDMDHQW LLEEWKGRIL YAISAWVADD ATS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462924.14e-33hypothetical protein SORBIDRAFT_02g034550
STRINGSb02g034550.11e-32(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3742233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46600.32e-23GRAS family protein