PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do024203.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 230aa    MW: 24959.9 Da    PI: 9.0294
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do024203.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45e-1897151256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++tkeq + Le+ F+ ++ +s++++ eLA++++L+ rqV vWFqNrRa+ k
  Do024203.1  97 RKKLRLTKEQSTLLEDTFRAHNILSHAQKHELARQVNLSARQVEVWFQNRRARTK 151
                 788899***********************************************98 PP

2HD-ZIP_I/II1154.5e-3797185189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  +kk+rl+keq++lLE++F++++ L++ +K+elar+++l++rqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+ en+rL++e ++L++
   Do024203.1  97 RKKLRLTKEQSTLLEDTFRAHNILSHAQKHELARQVNLSARQVEVWFQNRRARTKLKQTEVDCEILKRCCESLTGENQRLKHELAQLQR 185
                  69*************************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-1982152IPR009057Homeodomain-like
SuperFamilySSF466895.43E-1984154IPR009057Homeodomain-like
PROSITE profilePS5007117.34693153IPR001356Homeobox domain
SMARTSM003898.6E-1495157IPR001356Homeobox domain
CDDcd000864.49E-1497154No hitNo description
PfamPF000461.9E-1597151IPR001356Homeobox domain
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
SMARTSM003402.2E-15153196IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-9153184IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MYSASAMEAE DFGKSWLGLG IGGGGGGDLK RSHGEPRSSS VVQFDLLFPQ SVKEEAAAVG  60
TEAEKGARKR LKITTDDGRR SHETSPSDDG GDGAGTRKKL RLTKEQSTLL EDTFRAHNIL  120
SHAQKHELAR QVNLSARQVE VWFQNRRART KLKQTEVDCE ILKRCCESLT GENQRLKHEL  180
AQLQRSAAAA GIFVQFPRSA TAMATICPSC EKVTTATSGG DTSKSSSYSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195101TRKKLRL
2145153RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo024203.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9554316e-53EU955431.1 Zea mays clone 1531862 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966133.11e-130homeobox-leucine zipper protein HOX18
SwissprotQ5Z6F61e-62HOX18_ORYSJ; Homeobox-leucine zipper protein HOX18
TrEMBLA0A1E5VJN71e-168A0A1E5VJN7_9POAL; Homeobox-leucine zipper protein HOX18
STRINGSi007238m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-47homeobox from Arabidopsis thaliana