PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do024019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family LBD
Protein Properties Length: 194aa    MW: 21100.1 Da    PI: 7.8277
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do024019.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.47e-45131121100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrr+C+++Cv+apyfp e+p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lqqq++ql+ +lal+k+
  Do024019.1  13 PCASCKLLRRRCTQECVFAPYFPPEDPHKFAIVHKVFGASNVSKMLQELPAQQRADAVSSLVYEANARMRDPVYGCVGAISYLQQQISQLQMQLALAKA 111
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  Do024019.1 112 E 112
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.97412113IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-4413110IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:3.40.50.18203.7E-437140IPR029058Alpha/Beta hydrolase fold
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MAGSGSSSGS SSPCASCKLL RRRCTQECVF APYFPPEDPH KFAIVHKVFG ASNVSKMLQE  60
LPAQQRADAV SSLVYEANAR MRDPVYGCVG AISYLQQQIS QLQMQLALAK AEILCVHMQQ  120
DGHVTASPPS ASRQHQHQMD GEAYGSLHMQ NTLMNTMNST AIHQHQQMLG SLGSSGSTAM  180
MLQEACLKKE SLWA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-5061144112LOB family transfactor Ramosa2.1
5ly0_B3e-5061144112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo024019.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661028.15e-99LOB domain-containing protein 12
SwissprotQ8LBW39e-68LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1E5V6L61e-142A0A1E5V6L6_9POAL; LOB domain-containing protein 12
STRINGSi026864m6e-95(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-58LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]