PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do024006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 311aa    MW: 36260.6 Da    PI: 6.3162
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do024006.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS237.84.8e-73730274373
        GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAe 170
                 ++e l+a+ ++  ++    +++   N +I++a++g + v i+D+++++G+QWp+L++ +a+ ++gpp++RiTg++ p++g   + ++eetg+rL+k A+
  Do024006.1   7 VVEYLKAYWMYRAACCHKMMAFRFSNMTIYKAIAGRKLVYIVDYGLNYGFQWPNLFRRMATWEGGPPEVRITGIDLPQPGfhPAARIEETGRRLSKCAH 105
                 6677888999999999999999*********************************************************999***************** PP

        GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                 ++++pf ++++        ++++L+++p+E+l+Vn++l+  +l+de v+++s  +rd vL+ +++++P+v+++   + +++++ F+ rf eal +ys++
  Do024006.1 106 QFDMPFMWETV--------TIDDLDIDPDEVLIVNSILHFGNLMDEGVDTSSpsPRDVVLSNIRKMRPDVFILFVMNGSYSTPYFVPRFREALFHYSTM 196
                 ******99995........88999**********************999888779******************************************** PP

        GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                 fd+++a+ pr+s+ r+ vErel+g+ ++nv+aceg +r+er et+++W++r ++aG+k+++l+++++k+++  +r    + +  + ++++l+ gW +r 
  Do024006.1 197 FDMMDATTPRDSDLRNLVERELFGQCAQNVIACEGLDRVERPETYKQWQRRNHRAGLKQLRLDQDIVKDVREKVRDKFHEDFVTDVDHQWLLGGWTGRI 295
                 **************************************************************************9888788****************** PP

        GRAS 367 LvsvSaW 373
                 L+++S W
  Do024006.1 296 LYAMSTW 302
                 ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.1211283IPR005202Transcription factor GRAS
PfamPF035141.7E-707302IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAERISVVEY LKAYWMYRAA CCHKMMAFRF SNMTIYKAIA GRKLVYIVDY GLNYGFQWPN  60
LFRRMATWEG GPPEVRITGI DLPQPGFHPA ARIEETGRRL SKCAHQFDMP FMWETVTIDD  120
LDIDPDEVLI VNSILHFGNL MDEGVDTSSP SPRDVVLSNI RKMRPDVFIL FVMNGSYSTP  180
YFVPRFREAL FHYSTMFDMM DATTPRDSDL RNLVERELFG QCAQNVIACE GLDRVERPET  240
YKQWQRRNHR AGLKQLRLDQ DIVKDVREKV RDKFHEDFVT DVDHQWLLGG WTGRILYAMS  300
TWAAADAVLE S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-26430270374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450063.11e-163hypothetical protein SORBIDRAFT_05g027750
TrEMBLC5Y8L31e-163C5Y8L3_SORBI; Putative uncharacterized protein Sb05g027750
STRINGSb05g027750.11e-162(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46600.25e-99GRAS family protein