PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do023914.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family M-type_MADS
Protein Properties Length: 62aa    MW: 7119.61 Da    PI: 10.8977
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do023914.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.52.6e-21953145
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                k+ en+s r vt+skRr gi KKA+ELS+LCd++  +++fs+t k
  Do023914.1  9 KKLENNSARVVTYSKRRSGIVKKAKELSILCDIDLILLMFSPTEK 53
                5679**************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.623153IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-22160IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-27160IPR002100Transcription factor, MADS-box
CDDcd001209.93E-20254No hitNo description
PRINTSPR004041.4E-16323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MGRVKLKIKK LENNSARVVT YSKRRSGIVK KAKELSILCD IDLILLMFSP TEKPTICISE  60
RR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo023914.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677900.18e-30agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_008677901.18e-30agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_008677902.16e-30agamous-like MADS-box protein AGL65 isoform X2
RefseqXP_021317426.15e-30agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_021317427.15e-30agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_021317428.14e-30agamous-like MADS-box protein AGL65 isoform X2
SwissprotQ1PFA41e-22AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A1E5UX031e-35A0A1E5UX03_9POAL; Uncharacterized protein
STRINGSb05g025970.11e-29(Sorghum bicolor)
STRINGGRMZM2G441115_P013e-30(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.16e-15AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]