PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do023167.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 340aa    MW: 36823.1 Da    PI: 7.5405
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do023167.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62.1e-52291561128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeelv++yL++kv +  +     i+evd++++ePw+Lp +++ +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd+evl++ +g+
  Do023167.1  29 LPPGFRFHPTDEELVTFYLAAKVFNGACCG-VDIAEVDLNRCEPWELPGAARMGEREWYFFSLRDRKYPTGMRTNRATGAGYWKATGKDREVLNAaTGA 126
                 79************************9777.34***************8888899**************************************987889 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 l g+kktLvfykgrap+gekt+Wv+heyrl
  Do023167.1 127 LLGMKKTLVFYKGRAPRGEKTKWVLHEYRL 156
                 9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.27E-6221179IPR003441NAC domain
PROSITE profilePS5100558.16229179IPR003441NAC domain
PfamPF023653.6E-2730156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MHHQAMGDAL WDLLGEEMAA AAAAGEHGLP PGFRFHPTDE ELVTFYLAAK VFNGACCGVD  60
IAEVDLNRCE PWELPGAARM GEREWYFFSL RDRKYPTGMR TNRATGAGYW KATGKDREVL  120
NAATGALLGM KKTLVFYKGR APRGEKTKWV LHEYRLDGEF AAARRSCKEE WVICRILHKA  180
GDQYSKLMMV KNPYYLPMGM DPSSLCFQQD PAAAPPLPNS SGCTSVGLPF HHGHHHPGMQ  240
PPLLPNSQGK ISNGGCFPAL ACMQEPPNGS SSNTMGMPSY PPFTSIVAGK PAPLPSSQVG  300
VNAVGGPQEA PPPPPTWIEA YVQHGGFLYE MGPAAAPRGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-482917917165NO APICAL MERISTEM PROTEIN
1ut4_B2e-482917917165NO APICAL MERISTEM PROTEIN
1ut7_A2e-482917917165NO APICAL MERISTEM PROTEIN
1ut7_B2e-482917917165NO APICAL MERISTEM PROTEIN
3swm_A3e-482617917168NAC domain-containing protein 19
3swm_B3e-482617917168NAC domain-containing protein 19
3swm_C3e-482617917168NAC domain-containing protein 19
3swm_D3e-482617917168NAC domain-containing protein 19
3swp_A3e-482617917168NAC domain-containing protein 19
3swp_B3e-482617917168NAC domain-containing protein 19
3swp_C3e-482617917168NAC domain-containing protein 19
3swp_D3e-482617917168NAC domain-containing protein 19
4dul_A2e-482917917165NAC domain-containing protein 19
4dul_B2e-482917917165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0612700.0BT061270.1 Zea mays full-length cDNA clone ZM_BFb0128J16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974840.10.0PREDICTED: NAC domain-containing protein 92
SwissprotQ9S8518e-89NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLK3YML70.0K3YML7_SETIT; Uncharacterized protein
STRINGSi015498m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112373341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.16e-90NAC family protein