PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do023038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 817aa    MW: 89754.9 Da    PI: 6.3098
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do023038.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS394.98.4e-1214418102374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 ++lL++cA+ v+++d ++a+ lL++++++asp+gd  qRla++f+++L+arla+++s++yk++ +++ +    +++l+a++l+  ++P+ k+sh+ aNq
  Do023038.1 441 ETLLIHCAQSVATDDRRAATDLLKQIRQHASPNGDGDQRLAHCFANGLEARLAGNGSQIYKSVIMTRFP---CTDVLKAYQLYLAACPFKKISHFFANQ 536
                 789*************************************************************99999...9************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                 +Il+ave++++vHi+Df++ +G+QWp+L+q L++Rp+gpp+lR+Tg++ p++g   +e++eetg+ L+++A++++vpfef++ +a+r+e++++e+L+++
  Do023038.1 537 TILNAVEKAKKVHIVDFGVYYGFQWPCLIQRLSTRPGGPPKLRMTGIDTPHPGfrPAERIEETGRYLKDYAQTFNVPFEFKA-IASRFEAVQIEDLHIE 634
                 ***************************************************99*****************************.7*************** PP

        GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                 ++E l+Vn++++ ++l+desv  es+r+ vL+++++++P+v+++   + ++n++ F+ rf eal +ysa+fd+le+++pr++e+r  +E +l+gre+ n
  Do023038.1 635 KDELLIVNCMFKFKTLMDESVVAESPRNMVLNTIRKMNPDVFIHGIINGSYNAPFFVSRFREALFHYSAIFDMLETNIPRDNEQRLLIESALFGREAIN 733
                 *************************************************************************************************** PP

        GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 v++ceg er er et+++W  r ++aGFk++p++++++k  +  +r +++d + ++e++++l++gWk+r L+++S W+
  Do023038.1 734 VISCEGLERMERPETYKQWAVRNQRAGFKQLPINQDIMKRTREKVRCYHKD-FIIDEDNKWLLQGWKGRILLALSTWK 810
                 *************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.093414791IPR005202Transcription factor GRAS
PfamPF035142.9E-118441810IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MVMDAGLHEP CLLLPGSKRD AHLPIYPQVA AAAANGFTAE DLEALLFLPH DGIAAAAGGV  60
GGGYLNVAPT TVVPPASTNR AGASPPRKTA PATAPAAAGQ PDDSEAFSDI VLGYINRMLM  120
AEDIDDKFEH YPEHSALLAA EKPFLEILAE RPSSSGGSAV ESPDGSSVAN SCYSAGSCSC  180
AAAASDVFGA VLTPALDFPS AAFLQPPQLY QDLSPESSVV DAGAPWPYDP TEFYQLQTNP  240
VPEALLSQPP SFASSNGSGI ALSDGFESLL SSSGVMPDVG LTDFVVQSQQ AMQFCRGLEE  300
ASRFLPDESK LVIDLEKSAS ATSLLTNVKE EKRFVEVKAE KADVAGIHRG KKHFYGDDLD  360
AEEGRCSKHS ATPVDTDQLV REMMDKVLLC NGETCSKGVK ELREALQHDV AKHSHGGHGK  420
GSRHGKGRGK KQPKKEVVDL ETLLIHCAQS VATDDRRAAT DLLKQIRQHA SPNGDGDQRL  480
AHCFANGLEA RLAGNGSQIY KSVIMTRFPC TDVLKAYQLY LAACPFKKIS HFFANQTILN  540
AVEKAKKVHI VDFGVYYGFQ WPCLIQRLST RPGGPPKLRM TGIDTPHPGF RPAERIEETG  600
RYLKDYAQTF NVPFEFKAIA SRFEAVQIED LHIEKDELLI VNCMFKFKTL MDESVVAESP  660
RNMVLNTIRK MNPDVFIHGI INGSYNAPFF VSRFREALFH YSAIFDMLET NIPRDNEQRL  720
LIESALFGRE AINVISCEGL ERMERPETYK QWAVRNQRAG FKQLPINQDI MKRTREKVRC  780
YHKDFIIDED NKWLLQGWKG RILLALSTWK PDHKSSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-534448108375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970541.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3XEB70.0K3XEB7_SETIT; Uncharacterized protein
STRINGSi000234m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125183137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein