PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do023014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 473aa    MW: 49347.6 Da    PI: 8.1946
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do023014.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.61.4e-28254303251
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Do023014.1 254 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 303
                 9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-13251304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-25252303IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-21254306IPR006447Myb domain, plants
PfamPF002491.7E-5255303IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MEARAASAPD LSLHISLPSP SSAASPSPAP GRLGAAGGGG RGAQPAGGDP WRRLNGSTAS  60
TELSLSPPPR QEAAGDILPW RLRQPAANCS SSSSSSTATV EAAFVAVTVP RISLDAEAEV  120
EAAQARPIDG VPVYSTPRAT GHPFLGTSDY RQGHPKVGLY NPYHSSSWPS SLRSTTTSPA  180
VAPSASDPAA AFLSPSAYYR MLSGTGRLHL HGVLADTLRG YGGHHHHPPQ HFGNLASARY  240
MPKFPASRRV MRAPRMRWTS SLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS  300
HLQVEFELCW GSSFNSLILC SSSTVVGSCW GLGAQMYRTV KSTDKPATSS GPVDGGGSGD  360
DDLPGARQAP SAGGDVSPQP FTRHRSASSE GAASHAGGDV ECSSAEDSDG SRVRSGASSR  420
HEDQWLPPGA RNADTHRSVG ISSTTIEVPN QMSCPSPSLE FTLGRPNWNG AGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-14255303351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-14255303351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-14255303351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-14255303351Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo023014.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2865271e-138DQ286527.1 Zea mays KANADI1-like protein (kan1a) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025820099.10.0probable transcription factor RL9 isoform X1
SwissprotQ0J2356e-74ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A3L6RKZ80.0A0A3L6RKZ8_PANMI; Putative transcription factor RL9
STRINGPavir.Fb00812.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-38G2-like family protein