PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do022803.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family LBD
Protein Properties Length: 283aa    MW: 30097.8 Da    PI: 6.8809
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do022803.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.93.1e-4271061100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvh++FGasnv+kll++lp+ +reda++sl+yeAear+rdPvyG+v+ i+ lq +++q++ ela++++
  Do022803.1   7 PCAACKLLRRKCTQGCVFAPYFPPDNPAKFANVHRVFGASNVSKLLNELPQAQREDAVNSLAYEAEARLRDPVYGCVSYISVLQLRIKQTRDELAAARK 105
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  Do022803.1 106 E 106
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.536107IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DNPAKFANVH RVFGASNVSK LLNELPQAQR  60
EDAVNSLAYE AEARLRDPVY GCVSYISVLQ LRIKQTRDEL AAARKELAGY IGPAAFAPFV  120
APPQYHHHQY AGVPLAAAGM GLGVAPQHSH HPHQQIMAVQ QQHLHHQQMA EAQQIAAAVE  180
VAREQDFMMR QAAAYAHAIP GSSAGATVAV VPPDAVPYEG GFLFQQQQPP PSQAQTAVAL  240
TYQMEQSPPP SSSGQSHPEV SHQQNTDGSD EGSGGGGVVA PPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-4941108114LOB family transfactor Ramosa2.1
5ly0_B8e-4941108114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo022803.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3681341e-109AK368134.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2068L23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704292.11e-144LOB domain-containing protein 6
SwissprotQ9FKZ32e-61LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A1E5VYJ40.0A0A1E5VYJ4_9POAL; LOB domain-containing protein 36
STRINGSi036905m1e-143(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-57ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]