PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do022377.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 729aa    MW: 81019.7 Da    PI: 5.6325
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do022377.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS338.89.6e-1043497202373
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  +lL++cA+avs +d + a++lL r+++++sp gd++qRla++f+e+L+arla+++s++yk+l++++ts    +e l+a++l+  v+ +  +++   N 
  Do022377.1 349 HTLLIHCAQAVSMDDRQSATRLLRRIRQHSSPIGDANQRLAHCFAEGLEARLAGMGSQVYKSLKAKRTS---LVEYLKAYQLYLTVCCFKMMAYRFSNM 444
                 679****************************************************************99...*************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                 +I +a++g +++Hi+D+++ +G+QWp+Ll  La+R++gpp++RiTg++ p++g   + +++etg+rL+k A+++gvpf+f+  +a ++e++ + +L+++
  Do022377.1 445 TIANAIAGRKKLHIVDYGLRHGIQWPSLLGWLATREGGPPEVRITGIDLPQPGfrPAAQIKETGRRLSKCAHQFGVPFKFQS-IAAKWETVCVGDLNID 542
                 ****************************************************9*9***************************.799************* PP

        GRAS 198 pgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                 ++E+l++n  +   +l+de v++ s  +rd vL+ +++++P+v+++++ + +h ++ F++rf e l ++salfd+l+a++p ++++r  vEr l+gr +
  Do022377.1 543 RDEVLVINGLFDFGNLMDEGVDIYSpsPRDVVLSNIRKMQPDVFILCNINGSHAAPFFVTRFREVLFFFSALFDMLDATVPWDNDQRLLVERDLFGRFA 641
                 *********************9988779*********************************************************************** PP

        GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 +nv+aceg++r+erhet+++W+ r ++aG++++pl+ +++k ++  ++  + + + ++ ++++l+ gWk+r + ++S W
  Do022377.1 642 MNVIACEGSDRVERHETYKQWQVRNHRAGLQQLPLDPDIVKVVRKKVKDGYHKDFVIDVDNQWLLEGWKGRIICAMSTW 720
                 *************************************************99888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.307322701IPR005202Transcription factor GRAS
PfamPF035143.3E-101349720IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 729 aa     Download sequence    Send to blast
MAATPESTGT ADAEPFSPSA FLDLPPTPRP VGDFEDPAAS SDDLVLPFIS RMLMEEDIDD  60
KFFYHYPDHP ALLQVQQPYA QILSDAAAAS DSFTANNNGS DSCTLSPSSD ALSFANATRA  120
YHPACPGMGA GIDEFAAHDV NQLFFPQQDA ASARFPNGIE SSVLLDGAEE TTKTTTSPPT  180
VEGEHGAPAS TFPSFSGQNR VSMDMLNQAF LRGMEEAKKF LPTDNSLLVE ARGSKLSQGI  240
AAGEVRTEEK VDAMLTFQGI GGNGRGRKNR CNWQHVETET NRNSKLMVPE PEETGEMVDE  300
IIVNEYRLCL NGMLGMRIAM DSRDGKNISK GNGKSALGRQ RSNEVVDLHT LLIHCAQAVS  360
MDDRQSATRL LRRIRQHSSP IGDANQRLAH CFAEGLEARL AGMGSQVYKS LKAKRTSLVE  420
YLKAYQLYLT VCCFKMMAYR FSNMTIANAI AGRKKLHIVD YGLRHGIQWP SLLGWLATRE  480
GGPPEVRITG IDLPQPGFRP AAQIKETGRR LSKCAHQFGV PFKFQSIAAK WETVCVGDLN  540
IDRDEVLVIN GLFDFGNLMD EGVDIYSPSP RDVVLSNIRK MQPDVFILCN INGSHAAPFF  600
VTRFREVLFF FSALFDMLDA TVPWDNDQRL LVERDLFGRF AMNVIACEGS DRVERHETYK  660
QWQVRNHRAG LQQLPLDPDI VKVVRKKVKD GYHKDFVIDV DNQWLLEGWK GRIICAMSTW  720
IADDDFSEH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-403527208374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462924.10.0hypothetical protein SORBIDRAFT_02g034550
TrEMBLC5X9Z60.0C5X9Z6_SORBI; Putative uncharacterized protein Sb02g034550
STRINGSb02g034550.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-145GRAS family protein