PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do022106.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family CPP
Protein Properties Length: 426aa    MW: 46716.2 Da    PI: 7.5907
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do022106.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR42.81.1e-1366103139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 k+kk+CnC++skClk+YCeCf+++++C+  C+C++C N 
  Do022106.1  66 KKKKHCNCRNSKCLKMYCECFQEQQFCDG-CNCTNCGNI 103
                 589**************************.******996 PP

2TCR505.9e-16151190140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 k++kgC+Ckks ClkkYCeC++a++ Cs++C+C dCkN e
  Do022106.1 151 KHNKGCHCKKSGCLKKYCECYQANVLCSKNCRCMDCKNFE 190
                 589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-1166106IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.87167191IPR005172CRC domain
PfamPF036382.7E-1068102IPR005172CRC domain
SMARTSM011142.0E-18151192IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.4E-12154189IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MEQEKNQQPP QQQQPKPAIL AATGEMKAPA VAPQQPKPAA PAMPVSRQWP MAINPPSTEA  60
KSVTPKKKKH CNCRNSKCLK MYCECFQEQQ FCDGCNCTNC GNIVGNEKAR KEAINAIIQR  120
NPFAFQPKIE NGPSTHNVRK DNSGAVPLVP KHNKGCHCKK SGCLKKYCEC YQANVLCSKN  180
CRCMDCKNFE GSEERKALIQ GDYASDGNQV QQATSMALNG TIGSSGYNCS PVRRKRSHED  240
ALDNKVDGAT AEKEFHVNGG LSNGNCKQQE LKEASPMDIL IRGCSDQPNI NEMDSHWSDT  300
SKDSRPASPT TQALMCDEQE TSFGNDYRCS FPSASCDQDI SEIKSAQENL VFTGLREYLR  360
VIITRGKINE HKSSSEAATE SDGRQHHGAI PAFAPREVGE NIPSSNGIET PGINQQSTPN  420
DGSERQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952204.11e-140PREDICTED: protein tesmin/TSO1-like CXC 5
TrEMBLK3YRR51e-140K3YRR5_SETIT; Uncharacterized protein
STRINGSi016959m1e-139(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57552653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-75Tesmin/TSO1-like CXC domain-containing protein