PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family WOX
Protein Properties Length: 263aa    MW: 27729.5 Da    PI: 8.0618
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021930.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.82.5e-202180357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++t+eql +Lee+++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  Do021930.1 21 TRWCPTPEQLMILEEMYRGgLRTPNASQIQQITAHLacygRIEGKNVFYWFQNHKARDRQ 80
                8*****************99*************************************996 PP

2Wus_type_Homeobox118.33.5e-382081364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       +tRW+PtpeQ++iLee+y+ GlrtPn+++iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqk
         Do021930.1 20 STRWCPTPEQLMILEEMYRGGLRTPNASQIQQITAHLACYGRIEGKNVFYWFQNHKARDRQK 81
                       79***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003893.6E-41885IPR001356Homeobox domain
PfamPF000465.7E-182180IPR001356Homeobox domain
CDDcd000863.32E-52181No hitNo description
SuperFamilySSF466891.67E-102181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-72280IPR009057Homeodomain-like
PROSITE profilePS500719.7662681IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MPSQQGQPQP QPQQPVVAGS TRWCPTPEQL MILEEMYRGG LRTPNASQIQ QITAHLACYG  60
RIEGKNVFYW FQNHKARDRQ KLRRRLCMSH HLLSCAQYYA AHQGHGFLAA PPPAPYGCSV  120
FDQAAGQLLS PTSPTPAAAA AAAAAAAYGY YYPGTTAFAA APATRCAGAA TPPSPTQLLH  180
YQAGGGGGGG IAAVEALGRP EYSLGKLNNF GVALDDVVMS SAAAVDMGPP GFEVAPPPVA  240
FCRPLKTLDL FPGGLKEEQH DVA
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo021930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0401841e-128BT040184.1 Zea mays full-length cDNA clone ZM_BFc0070F13 mRNA, complete cds.
GenBankKJ7269461e-128KJ726946.1 Zea mays clone pUT3492 HB transcription factor (HB82) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025809937.11e-132putative WUSCHEL-related homeobox 2
TrEMBLA0A1E5VXX10.0A0A1E5VXX1_9POAL; Putative WUSCHEL-related homeobox 2
STRINGPavir.J22602.1.p1e-133(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.15e-41WOX family protein