PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021881.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TCP
Protein Properties Length: 202aa    MW: 21131.3 Da    PI: 12.4448
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021881.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP77.63.6e-24100181788
         TCP   7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                 r  ++hTkv+g  R +R+ a+ca r+  L++ L + ++++ti WLlqq++pai+++tgt++ +  ++  ++ +     s+ +
  Do021881.1 100 RYRDRHTKVEGCRRCIRMAAPCATRVARLTRDLEHRSNGETIRWLLQQSEPAIIAATGTGTVPTIAVPGSNGVLRLPPSRPP 181
                 778********************************************************66665444222223222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136917.207101155IPR017887Transcription factor TCP subgroup
PfamPF036348.8E-19102163IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MLSSRRRRAC RTSSSGAAAC RPPARVPLRA VLLPGARLPL LGLAACLLLR SATEAASLPS  60
SPGPRASSSA SPTSPASPCR WSSWAAGSRA PPRAPRPAPR YRDRHTKVEG CRRCIRMAAP  120
CATRVARLTR DLEHRSNGET IRWLLQQSEP AIIAATGTGT VPTIAVPGSN GVLRLPPSRP  180
PRAPTPSSKS SSRPPSAAAS SS
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo021881.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1E5VRH61e-129A0A1E5VRH6_9POAL; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.18e-27TCP family protein