PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do021853.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 653aa    MW: 71997.5 Da    PI: 6.3719
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do021853.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS316.26.9e-972776482374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  + L++cAeavs +d + a  lL +++ ++sp+gd mqRla+y++ +L+ar+a++++ely++l ++ ts   ++  l+a++lf  ++ ++ +++   N 
  Do021853.1 277 HTMLIRCAEAVSCHDRRGAADLLLQIRGHSSPTGDGMQRLAHYLADGLEARMAGTGNELYQSLVAKGTS---TACILKAHQLFLGTCFFFPVQYPFSNT 372
                 578***************************************************************999...8999*********************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                 +I +a++g +++Hi+ +++++GlQWp Ll+ L++R++gpp++R+Tgv++p +g   ++ +eetg+rL+  A+++gvpf+f+  +a + ++++ e+L+++
  Do021853.1 373 TIRNAAAGRKKLHIVHYGLGHGLQWPDLLRCLSCREGGPPEVRLTGVDNPLPGfhPARLIEETGRRLSACARQFGVPFKFRG-IAAKSDAVHAEDLNID 470
                 **************************************************999999999***********************.6999************ PP

        GRAS 198 pgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  +E+l+Vn+ ++  +l+desv ++   +rd vL+++k+++Pkv+++   + +h ++ F+ rf +al++y+alfd++++ ++r+++ r  vE+ +++r +
  Do021853.1 471 ADEVLVVNCFYHFRTLMDESVVVDRpnPRDLVLRTIKKMRPKVFIHGVFNGSHCAAYFMSRFRDALHHYTALFDMMDTIVARDNDMRLQVEQGIFARCA 569
                 ********************98776669*********************************************************************** PP

        GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 vnv+acega+r+er ++++kW++r ++aG++ +pl+ +++    + +++ + + + ++e++g+l+ gWk+r L+++S W+
  Do021853.1 570 VNVIACEGADRVERSQSYKKWEARSQRAGLRLLPLDPEIVRMLTAKVKESH-KYFVINEDHGWLLHGWKGRMLYALSTWT 648
                 ******************************************999999999.55*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509749.442157IPR004223Vitamin B12-dependent methionine synthase, activation domain
PROSITE profilePS5098555.803250629IPR005202Transcription factor GRAS
PfamPF035142.4E-94277648IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009086Biological Processmethionine biosynthetic process
GO:0005622Cellular Componentintracellular
GO:0008705Molecular Functionmethionine synthase activity
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
MSPASSPSAF LDLPPTPHVY GSSSKDDDLV LPYIARMLME EEEEEDMLVD RLSYYQHADH  60
HQALLRAQQP FAHILSGASS DAGLGAWPYG STVELSPLVS AAPGPCYSDD IDTLAATVLS  120
QGNNVDTTLS FSLNAPSTDT VEPPSSFLPA ESSCMDDLAT TAFFKGMEEG SKFLPTDSKR  180
ADGTGRRKRL EGASEVEVEA AMRRSSKQMA APQPESEEES AAREMMDKLM LTGYDACLAD  240
TNNTQDSRGA MDTAKTPPPP KGRSGSASPA RHAVDLHTML IRCAEAVSCH DRRGAADLLL  300
QIRGHSSPTG DGMQRLAHYL ADGLEARMAG TGNELYQSLV AKGTSTACIL KAHQLFLGTC  360
FFFPVQYPFS NTTIRNAAAG RKKLHIVHYG LGHGLQWPDL LRCLSCREGG PPEVRLTGVD  420
NPLPGFHPAR LIEETGRRLS ACARQFGVPF KFRGIAAKSD AVHAEDLNID ADEVLVVNCF  480
YHFRTLMDES VVVDRPNPRD LVLRTIKKMR PKVFIHGVFN GSHCAAYFMS RFRDALHHYT  540
ALFDMMDTIV ARDNDMRLQV EQGIFARCAV NVIACEGADR VERSQSYKKW EARSQRAGLR  600
LLPLDPEIVR MLTAKVKESH KYFVINEDHG WLLHGWKGRM LYALSTWTSD DDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-412806478374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450076.10.0hypothetical protein SORBIDRAFT_05g027820
SwissprotO809331e-130SCL9_ARATH; Scarecrow-like protein 9
TrEMBLC5Y1T00.0C5Y1T0_SORBI; Putative uncharacterized protein Sb05g027820
STRINGSb05g027820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-131GRAS family protein